PAE1

Pectin acetylesterase 1

388 amino acids

Hydrolyzes acetyl esters in homogalacturonan regions of pectin. In type I primary cell wall, galacturonic acid residues of pectin can be acetylated at the O-2 and O-3 positions. Decreasing the degree of acetylation of pectin gels in vitro alters their physical properties.

Belongs to the pectinacetylesterase family.

42.345 kDa

MKTLLYWGWSSLAGLILFSILAHGEMKTFNESNGTNANVLMVGLTLVQAAAAKGAVCLDGSVPGYHLCRGYGSGANNWIIQLQGGAWCDSIQNCQSRKGSGYGSSTLMEKELAFLGLLSNKAAENPDFYNWNKVKVRYCDGASFDGDSENKAAQLQYRGKRIFLAVMEDLMEKGMRQAKQALLSGCSSGGLSAILRCDDFNNLFPPTTTVKCMSDAGFFLDAVDVSGGHSLRRMYSGVVNTQGLQNTLPPTCTSHIKPFLCFFPQYIINQVKTPLFILNSGFDSWQIGNSLAPPSADKSGSWHNCSFSFRCTASQMHFLEGFKMSMLDALKTFSKFSKNGVLITSGWAHCQAERQDTWFPGYSGAGKAKGIAVAVGDWYFERTKQNSS

PAE1

Proteasome subunit alpha type-5-A

237 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.

Belongs to the peptidase T1A family.

25.947 kDa

MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEIDDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGEEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQEQFNKDLSLQEAETIAVSILKQVMEEKVTPNNVDIAKVAPAYHLYTPQEVEAVIARL

PAE1

Proteasome subunit alpha type-5

237 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.

Belongs to the peptidase T1A family.

25.993 kDa

MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGLKTKDGVVLAVEKRVTSPLLEPSSVEKIMEIDEHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQAICDLALRFGEGDEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQEQYNKELTLQEAETIALSILKQVMEEKVTPNNVDIAKVSPNYHLYTPAEVEAVIARL

PAE1

Proteasome subunit alpha type-5

237 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.

Belongs to the peptidase T1A family.

25.98 kDa

MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGLKTKEGVVLAVEKRITSPLLEPSSVEKIMEIDEHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGDEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTFWQCNGKAIGSGSEGADSSLQEQFNKDLTLQEAETIALSILKQVMEEKVTPNNVDIAKVAPTYHLYTPSEVEAVISRL