Protein
Flavin prenyltransferase PAD1, mitochondrial
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Function
Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for the ferulic acid decarboxylase FDC1/ubiD (PubMed:25647642). The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN (By similarity). Involved in the decarboxylation of phenylacrylic acids like ferulic acid, p-coumaric acid or cinnamic acid, producing the corresponding vinyl derivatives which play the role of aroma metabolites. Also involved in the degradation of the food preservative sorbic acid (2,4-hexadienoic acid) to a volatile hydrocarbon, 1,3-pentadiene. Not essential for ubiquinone synthesis (PubMed:17889824, PubMed:20471595). Can rescue Q biosynthesis in E.coli strains lacking UbiX (PubMed:17889824). Has mRNA binding activity (PubMed:20844764).
Similarity
Belongs to the UbiX/PAD1 family.
Sequence
MLLFPRRTNIAFFKTTGIFANFPLLGRTITTSPSFLTHKLSKEVTRASTSPPRPKRIVVAITGATGVALGIRLLQVLKELSVETHLVISKWGAATMKYETDWEPHDVAALATKTYSVRDVSACISSGSFQHDGMIVVPCSMKSLAAIRIGFTEDLITRAADVSIKENRKLLLVTRETPLSSIHLENMLSLCRAGVIIFPPVPAFYTRPKSLHDLLEQSVGRILDCFGIHADTFPRWEGIKSK