About Products Protein Database Contact

P26

Gene
P26
Protein
Poxin
Organism
Autographa californica nuclear polyhedrosis virus
Length
240 amino acids
Function
Nuclease that cleaves host 2',3'-cGAMP.
Similarity
Belongs to the poxin family.
Mass
27.282 kDa
Sequence
MELYNIKYAIDPTNKIVIEQVDNVDAFVHILEPGQEVFDETLSQYHQFPGVVSSIIFPQLVLNTIISVLSEDGSLLTLKLENTCFNFHVCNKRFVFGNLPAAVVNNETKQKLRIGAPIFAGKKLVSVVTAFHRVGENEWLLPVTGIREASQLSGHMKVLNGVRVEKWRPNMSVYGTVQLPYDKIKQHALEQENKTPNALESCVLFYKDSEIRITYNKGDYEIMHLRMPGPLIQPNTIYYS
Protein

Gene
p26
Protein
Poxin
Organism
Bombyx mori nuclear polyhedrosis virus
Length
240 amino acids
Function
Nuclease that cleaves host 2',3'-cGAMP.
Similarity
Belongs to the poxin family.
Mass
27.348 kDa
Sequence
MELYNIKYAIDPTNKIVIEQVDNVDAFVHILEPGQEVFDETLSRYHQFPGVVSSIIFTQLVLNTIISVLSEDGSLLPLKLENTCFNFHVCNKRFVFGNLPAAIVNNETKQKLRIGSPIFAGEKLVSVVTTFHRVGENEWLLPVTGIQEASRLSGHIKVPNGVRVEKLRPNMSVYGTVQLPYDKIKRHALEQENKTPNALESCVLFYRDSEIRITYNRGDYEIMHLRMPGPLIQPNTIYYS
Protein

Gene
P26
Protein
Protein p26
Organism
Orgyia pseudotsugata multicapsid polyhedrosis virus
Length
230 amino acids
Similarity
Belongs to the baculoviridae p26 family.
Mass
25.565 kDa
Sequence
MYIKMEVEFDEDTGALQIGGQEVFVMVFEPGQEVFDKSLDQHHQFPGVATSVVFPQLSIGTKVDVFTSSGGFGATDHHCFNYHVCNKRFVFGSVPALEIPADVREHLRIGAPITCADRLVSLVTAVHAADGAWLLRVTAARAGQVSGHARQQRRGAGRTVRAGRSVYGPVQLPYEQLKAHAFRKRRPRRDAAESCALFYNDSEVRITFNKGEFELMHWRLPGPLVSHGFK

Gene
P26
Protein
Protein P26
Organism
Beet necrotic yellow vein virus (isolate Japan/S)
Length
228 amino acids
Function
Probably influences symptom severity in a synergistic fashion with P25.
Similarity
Belongs to the benyvirus P25 protein family.
Mass
26.15 kDa
Sequence
MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPLQVDLNDNVEVGADIYHMKIKTMRFNVDIYNNDVATKFPGWVRFIVFCTPPVSSWVNDGCSSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCHQEHFTRSFEFNFRGPGNYTLTSDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHKRFWQRPVLEFGQCLDDLPDHDNDCG