Function
Component of an E3 ubiquitin ligase complex that plays a central role in blue light-dependent circadian cycles. Acts as a blue light photoreceptor, due to the presence of FMN, that mediates light-regulated protein degradation of critical clock components by targeting them to the proteasome complex. The SCF(ADO3) E3 ubiquitin ligase complex is involved in the regulation of circadian clock-dependent processes including transition to flowering time, hypocotyl elongation, cotyledons and leaf movement rhythms (By similarity).
Sequence
MFDAGDRGGGGGVVAVKRMKLCEEEEEEEEGMEVDEEEEEVGWVWRPPGGLAGEDEAAAWEGRAAAIVVSDAVEVDFPVIYVNAAFEAATGYRADEVLGRNCRFLQFRDPRAQRRHPLVDPMVVSEIRRCLNEGIEFQGELLNFRKDGAPLYNRLRLIPMHGDDGFVTHVIGIQLFSEANIDLSNVSYPVYKQQSNHRPNIQEINPASHEHIPKIQSSEYCCILQLSDEVLAHNILSRLSPRDVASIGSVCTRMHELTKNDHLRKMVCQNAWGRDVTVRLEMSTKMLGWGRLARELTTLEAASWRKFTVGGRVEPSRCNFSACAVGNRLVLFGGEGVNMQPMDDTFVLNLESAKPEWRRVKVSASPPGRWGHTLSWLNGSWLVVFGGCGQQGLLNDVFVLDLDAKQPTWREVASEGPPLPRSWHSSCTLDGSKLVVSGGCTESGVLLSDTFLLDLTKEKPAWKEIPTSWSPPSRLGHTLSVFGKTKLFMFGGLAKSGSLRLRSCDAYTMDAGEDSPQWRQLATTGFPSIGPPPRLDHVAVSLPCGRIIIFGGSIAGLHSPSQLFLLDPAEEKPTWRILNVPGQPPKFAWGHSTCVVGGTRVLVLGGHTGEEWILNELHELCLASRPDEDE