Function
Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Highly sensitive to the sex pheromone of the silkworm moth, bombykol. Intriguingly, the fruit fly detectors are more sensitive than the receptors of the silkworm moth, although its ecological significance is unknown. Responds also to pyrazines.
Sequence
MAVSTRVATKQEVPESRRAFRNLFNCFYALGMQAPDGSRPTTSSTWQRIYACFSVVMYVWQLLLVPTFFVISYRYMGGMEITQVLTSAQVAIDAVILPAKIVALAWNLPLLRRAEHHLAALDARCREQEEFQLILDAVRFCNYLVWFYQICYAIYSSSTFVCAFLLGQPPYALYLPGLDWQRSQMQFCIQAWIEFLIMNWTCLHQASDDVYAVIYLYVVRIQVQLLARRVEKLGTDDSGQVEIYPDERRQEEHCAELQRCIVDHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINIFIFANTNTKIASIIYLLAVTLQTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLIKGMNLGERFNRTN