ORF3a

Movement protein

337 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

36.494 kDa

MAGLWRSNSTLDVERGRNRTQTETVQTVPRQAQGILELLSSPAAREALQGSDFARWRGVPVSPAGGYFELAPLRSVNTFARGLRSVFGGSTSRREAYIPQHGFYRLNYVLVAVVPHVEHSDPGEVTVQLVENTNPTRAVDGQELTARLADGSFVFAAAPTYDIVLEQAPILVEGESAGVVQRMFGIRTSVSGSLTTGSVVSVYPIWSAEFPIQGATFNHVAPSIVHIDRFNRSVAFEIDVLRRRFSLMRPLHLARSRESFQVGRMSLDVARPSVVRPPPVDPQAEGGIHVNSPTSEQSQGEDRVPRAGLASGTSVGEGANHEFLSGAVKSTAPVRQT

ORF3a

Movement protein

309 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

33.757 kDa

MSLIRRSTSHQLNALDNSLQSYLGSQEFKEDMREQAGFGRWKRVKASAGEKPIVLVPDNSYSALKALMKSEYEKGLIPSKGYMHLKWCLVFIVAHVPKETMGEVCIELRDPGISTADPLPGCQVVCALSDLPRAVMLVPDYDMPLGKSKLRLGNQEMRRMFFLHTKVSGFTGQGVAISLFPVWDCDFRGTCNNYVKVPAVSVGIDRTERTSLLNCVKQLKQYAENALLTMPQSISGGTSFARPSHLSLNESKTLPSTSTTEAEGSERRIHIGAPSNEDLYEVKSAGTTGGPVSLVNGVSVGASTQSAFF

ORF3a

Movement protein

303 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids.

Belongs to the bromovirus movement protein family.

32.482 kDa

MSNIVSPFSGSSRTTSDVGKQAGGTSDEKLIESLFSEKAVKEIAAECKLGCYNYLKSNEPRNYIDLVPKSHVSAWLSWATSKYDKGELPSRGFMNVPRIVCFLVRTTDSAESGSITVSLCDSGKAARAGVLEAIDNQEATIQLSALPALIALTPSYDCPMEVIGGDSGRNRCFGIATQLSGVVGTTGSVAVTHAYWQANFKAKPNNYKLHGPATIMVMPFDRLRQLDKKSLKNYIRGISNQSVDHGYLLGRPLQSVDQVAQEDLLVEESESPSALGRGVKDSKSVSASSVAGLPVSSPTLRIK

ORF3a

Movement protein

302 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the bromovirus movement protein family.

33.363 kDa

MSNTTFRPFTGSSRTVVEGEQAGAQDDMSLLQSLFSDKSREEFAKECKLGMYTNLSSNNRLNYIDLVPKNTGSRALNLFKSEYEKGHIPSSGVLSIPRVLVFLVRTTTVTESGSVTIRLVDLISASSVEILEPVDGTQEATIPISSLPAIVCFSPSYDCPMQMIGNRHRCFGLVTQLDGVISSGSTVVMSHAYWSANFRSKPNNYKQYAPMYKYVEPFDRLKRLSRKQLKNYVRGITNQSVNHGYLLGKPLLKTDEQDPEMIVLEEESLTPTDSNGVGKDKIAVTAKSVAGLPTASLSINRR

ORF3a

Movement protein

300 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids.

Belongs to the alfamovirus movement protein family.

32.374 kDa

MENTKTNASSSGMSSSSSFSVSYAEEMLLADEVSKTNSMSILGPNQLKLCTQLVLSNGAAPVVLSLVSKEKKSILNRMLPKIGQRMYVHHSAIYLLYMPNILKSSSGSITLKLFNEATGELVDVDTDHDATQACIFAGRYPRSILAKDAAKGHDLKLVVHAVASTNMNSAVGVLYPIWEDELSRKQILERGADFLKFPIAKTEPVRDLLNAGKLTDFVLNRTRLGVGSKSDPSPVLLEPRAKIAGKAKTLFIPEGPSVPSTTINGMAPTVRIDAGSPKGLGVPKGFTYESFIKDEILPDH

ORF3a

Movement protein

300 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the alfamovirus movement protein family.

32.398 kDa

MENTKTNASSSGMSSSSSFSVSYAEEMLLADEVSKINSMSILGPNQLKLCTQLVLSNGAAPVVLSLVSKEKKSILNRMLPKIGQRMYVHHSAIYLLYMPNILKSSSGSITLKLFNEATGELVDVDTDHDATQACIFAGRYPRSILAKDAAKGHDLKLVVHAVASTNANSAVGVLYPIWEDELSRKQILERGADFLKFPIAETEPVRDLLNAGKLTDFVLDRTRLGVGSKNDPSPVLLEPRAKITGKAKTVFIPEGPSVPNTTINGMAPTVRIDAGSPKGLGVPKGFTYESFIKDEILPDH

ORF3a

Movement protein

300 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the alfamovirus movement protein family.

32.479 kDa

MENTKTNASSSGMFSSSSFSVSYAEEMLLADEVSKINSMSILGPNQLKLCTQLVLSNGAAPVVLSLVSKEKKSISNRMLPKIGQRMYVHHSAIYLLYMPNILKSSSGSITLKLFNEATEELVDVDTDHDATQACIFAGRYPRSILAKDAAKGHDLKLVVHAVASTKANSAVGVLYPIWEDELSRKQILERGADFLKFPIAETEPVRDLLNAGKLTNFVLDRTRLGVGSKSDPSPVLLEPRAKITGKAKTFFIPEGPSVPNTTISGIAPSVRIDAGSPKGLGVPKGFTYESFIKDEILPDH

ORF3a

Movement protein

300 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the alfamovirus movement protein family.

32.395 kDa

MENTKTNASSSGMSSSSSFSVSYAEEMLLADEVSKINSMSILGPNQLKLCTQLVLSNGAAPVVLSLVSKEKKSILSRILPKIGQRLYVHHSAIYLLYMPNILKSSSGSITLKLFDEATEELVDVDTDHDATQACIFAGRYPRSILAKDAAKGHDLKLVVHAVASTKANSAVGVLYPIWEDELSRKQILERGADFLKFPIAETEPVRDLLNAGKLTDFVLDRTRLGVGSKNDPSPVLLEPRAKITGKAKTVFIPEGPSVPNTTISGMAPTVRIDAGSPKGLGVPKGFTYESFIKDEILPDH

ORF3a

Movement protein

295 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the bromovirus movement protein family.

32.597 kDa

MSNISSLNPFSGSSRTLVENKQVGASDAESLLKEMFSLEAQKEYAKECNLGRYTELKANRRLNHIDLVPKVHGMKMLSMFRSEYDKGNVPSSGVLNIPRILLYLVRTSHSSTVGSITIRLVDTYSASDSCLLEAIDGQEFTVDLSSLPCMIGFSPTYDCKLEMVDGRRRCFGIVTELNGVIGEGHTVAMVHAYWKAMFRTKPGNYTRVKPAAKFIAPFDRLKQLSSGQLDAFIKGISNNSIDHGYLMGSTINNIKKKTNVKEESPTSDPQSGEVSSMTQSVPGAADTRIPKPRRR

ORF3a

Movement protein

289 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the ilarvirus movement protein family.

31.675 kDa

MALAPTMKALTFSADDETSLEKAVTEALSGSVDLNMGLRRCAAFPAENTGAFLCELTTKETKSFIGKFSDKVRGRVFIDHAVIHMMYIPVILNTTHAIAELKLKNLATGDELYGGTKVNLNKAFILTMTWPRSLFAEAVHNHKGLYLGGTVSCASSVPAHAKIGMWYPIWSEKVSIKQLYQNTIDIHKTEAIETFTPTMISSDKEMRSLLRSRASIDVAAKTREKPVICSERVSLLDQHTQGVDFTVTEIEPEKDDDAGTSILGPKMVPIEQVPSVKLSSEAGRNLLTA

ORF3a

Movement protein

288 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

31.418 kDa

MAFSGSSRTLTQQSSAASTDDLHKILFSPEAIKEMATKCDLGRHHWLRADDAVCVRPLVPETTSNKVAQWFKTGYEAGKLPSKGYMIIPQVLCAVTRTVTSNAEGSLEIYLADLGDVELAPIDDQVVTLHNRDLPALISFQPTYDCPMEKVGDRSRCFAVVIKRHGYLGHPGSTASVCSNWQPKFSSKNNNYKPAAAGKTLVLPYNRLSELSGPSAVVRLLKSQLNMQSSPLFQLPGGPIMQKAIGSEREEGLNCKRKLPLEEVCTTSRDSVSSRPSVVNGIERPGTL

ORF3a

Movement protein

283 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.952 kDa

MAFQGTSRTLTQQSSAATSDELQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDAGELSSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVTLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYVLTNAKINQNARSESEELNVESPPIAIGSSSASRSETFRPQVVNGTLVFS

ORF3a

Movement protein

280 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.555 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNAKINQNAHVSESEELNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.51 kDa

MAFQGTSRTLTQQSSAATSDELQKILFSPEAIKKMAAECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDAGELCSKGCVSVPQVLCAVTRTVSTDAEGSLRIYLPDLGDKELSPIDKQCVTLHNHHLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNMGSSQYVLTDSKINQNARSESEELNVESPPAAIGSSVASRFESFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.497 kDa

MAFQGTSRTLTQQSSAATSDELQKILFSPDAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGSIASFFKSGYDAGELRSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETIGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYVLSKAKINQNARSESEELNVESPSFAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.505 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHSRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNAKINQNARSESEELNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.461 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNAKINQNARSESEDLNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.547 kDa

MAFQGTSRTLTQQSSADTSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNVKINQNARSESEELNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.677 kDa

MAFQGTSRTLTQQSSAATSDELQKLLFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDAGELSSKGYMSVTQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDRQCVTLHNHDLPALVSFQPTYDCPMESVGNRKRCFAVVIERHGYIEYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYVLTDAKINQNARSESEEIIVESPPIVIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.288 kDa

MAFQGTSRTLTQQSSAASSGDLQKILFSPDAIKKMATECDLGRHHWMRADNAISVRPLVPQVTSNNLLSFFKSGYDAGELRSKGYMSVPQVLCAVTRTVSTDAEGSLKIYLADLGDKELSPIDGQCVTLHNHELPALISFQPTYDCPMELVGNRHRCFAVVVERHGYIGYGGTTASVCSNWQAQFSSKNNNYTHAAAGKTLVLPYNRLAEHSKPSAVARLLKSQLNNVSSSRYLLPNVALNQNAAGHESEILNESPPFAIGSPSASRNNSFRSQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.619 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNVKINQNARSESEDLNVESPPAAIGRFSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.582 kDa

MAFQGTSRTLTQQSSAATSDELQKILFSPDAIKKMAAECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDAGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDKQCVTLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVVERHGYVGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYVLTDSKINQNARSESEELNVESPPVAIGSSSASRFESFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.461 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYVLTNAKINQNARSESEELNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.448 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADSAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNAKINQNARSESEELNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.503 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNVKINQNARSESEELNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.348 kDa

MAFQGPSRTLTQQSSAASSDDLQKILFSPDAIKKMATECDLGRHHWMRADNAISVRPLVPQVTSNNLLPFFKSGYDAGELRSKGYMSVPQVLCAVTRTVSTDAEGSLKIYLADLGDKELSPIDGQCVTLHNHELPALISFQPTYDCPMELVGNRHRCFAVVVERHGYIGYGGTTASVCSNWQAQFSSKNNNYTHAAAGKTLVLPYNRLAEHSKPSAVARLLKSQLNNVSSSRYLLPNVALNQNASGHESEILKESPPIAIGSPSASRNNSFRSQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.342 kDa

MAFQGTSRTLTQQSSAASSDDLQKILFSPDAIKKMATECDLGRHHWMRADNAISVRPLVPQVTSNNLLSFFKSGYDAGELRSKGYMSVPQVLCAVTRTVSTDAEGSLKIYLADLGDKELSPIDGQCVTLHNHELPALISFQPTYDCPMELVANRHRCFAVVVERHGYIGYGGTTASVCSNWQAQFSSKNNNYTHAAAGKTLVLPYNRLAEHSKPSAVARLLKSQLNNVSSSRYLLPNVALNQNASGHESEILNESPPIAIGSPSASRNNSFRSQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.362 kDa

MAFQGTSRTLTQQSSAASSDDLQKILFSPDAIKKMATECDLGRHHWMRADNAISVRPLVPQVTSNNLLSFFKSGYDAGELRSKGYMSVPQVLCAVTRTVSTDAEGSLKIYLADLGDKELSPIDGQCVTLHNHELPALISFQPTYDCPMELVGNRHRCFAVVVERHGYIGYGGTTASVCSNWQAQFSSKNNNYTHAAAGKTLVLPYNRLAEHSKPSAVARLLKSQLNNVSSSRYLLPNVALNQNASGHESEILNESPPFAIGSPSASRNNSFRSQVVNGL

ORF3a

Movement protein

279 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.475 kDa

MAFQGTSRTLTQQSSAATSDDLQKILFSPEAIKKMATECDLGRHHWMRADNAISVRPLVPEVTHGRIASFFKSGYDVGELCSKGYMSVPQVLCAVTRTVSTDAEGSLRIYLADLGDKELSPIDGQCVSLHNHDLPALVSFQPTYDCPMETVGNRKRCFAVVIERHGYIGYTGTTASVCSNWQARFSSKNNNYTHIAAGKTLVLPFNRLAEQTKPSAVARLLKSQLNNIESSQYLLTNAKINQNARSESEELNVESPPAAIGSSSASRSEAFRPQVVNGL

ORF3a

Movement protein

277 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids (By similarity).

Belongs to the cucumovirus movement protein family.

30.532 kDa

MAFSGTSRTLTQQSSAASTDELHNILFSRRAIQEMATKCDLGRHHWMRADNAVCVRPLVPETTSNLLTRWFVSGYEAGELPSKGYMSVPQVLCAVTRTVTSDAEGSLRIYLADLGDKERAPIDAQVVSLHNRDLPAIVSFHPTYDCPMEQLNGVGRCFALVIERCGYIGHNGTTASVCSNWQPKFSSKNNNYKPAAAGKTLVLPYDRLSELSGPSAVARLLKSQLNMSASRIQLPGYVFNVRYVVSLRILRNRQSQPNARVDSEPQVFSKPVVVNGI