Orai1

Calcium release-activated calcium channel protein 1

304 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT.

Belongs to the Orai family.

33.062 kDa

MHPEPAPPPSHSNPELPVSGGSSTSGSRRSRRRSGDGEPSGAPPLPPPPPAVSYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGLLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPAESVIVANHSDSSGITPGEAAAIASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPGTHYA

Orai1

Calcium release-activated calcium channel protein 1

304 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT.

Belongs to the Orai family.

33.04 kDa

MHPEPAPPPNNSNPELPLSGGSSTSGSRRSRRRSGDGEPTGAPPLPPPPAVSYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGLLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPTEPAVVVANSSNNGGITPGEAAAIASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPGTHYA

Orai1

Calcium release-activated calcium channel protein 1

304 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT.

Belongs to the Orai family.

33.062 kDa

MHPEPAPPPSHSNPELPVSGGSSTSGSRRSRRRSGDGEPSGAPPLPPPPPAVSYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGLLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPAESVIVANHSDSSGITPGEAAAIASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPGTHYA

Orai1

Calcium release-activated calcium channel protein 1

304 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT.

Belongs to the Orai family.

33.04 kDa

MHPEPAPPPNNSNPELPLSGGSSTSGSRRSRRRSGDGEPTGAPPLPPPPAVSYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGLLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPTEPAVVVANSSNNGGITPGEAAAIASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPGTHYA

ORAI1

Calcium release-activated calcium channel protein 1

301 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1 (PubMed:16582901, PubMed:16645049, PubMed:16733527, PubMed:16766533, PubMed:16807233, PubMed:19249086, PubMed:23307288, PubMed:24351972, PubMed:24591628, PubMed:28219928). CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT (PubMed:16582901).

Belongs to the Orai family.

32.668 kDa

MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA

ORAI1

Calcium release-activated calcium channel protein 1

301 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1 (PubMed:16582901, PubMed:16645049, PubMed:16733527, PubMed:16766533, PubMed:16807233, PubMed:19249086, PubMed:23307288, PubMed:24351972, PubMed:24591628, PubMed:28219928). CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT (PubMed:16582901).

Belongs to the Orai family.

32.668 kDa

MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA

orai1

Calcium release-activated calcium channel protein 1

258 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.

Belongs to the Orai family.

28.737 kDa

MYPECGVETKSRPCSKQLQEEVSYPEWISRSYVELMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLEPNHAYPPGLLIAFSACTTVLVAVHLFALMVSTCILPNIEAVSNVHNLNSVKESPHERMHHHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPVNSPKISSNETSAVSSGQAAAITSTAIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELNELAELAQLQDQLDHRGDPVQSPVHYA

orai1

Calcium release-activated calcium channel protein 1

258 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.

Belongs to the Orai family.

28.737 kDa

MYPECGVETKSRPCSKQLQEEVSYPEWISRSYVELMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLEPNHAYPPGLLIAFSACTTVLVAVHLFALMVSTCILPNIEAVSNVHNLNSVKESPHERMHHHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPVNSPKISSNETSAVSSGQAAAITSTAIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELNELAELAQLQDQLDHRGDPVQSPVHYA

ORAI1

Calcium release-activated calcium channel protein 1

226 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.

Belongs to the Orai family.

25.13 kDa

MSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDAEHDYPRGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKNPLDPAENSNSSITSGQAAAIASTSIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFAWLQDQLDHRGDAISPAVTHFA

ORAI1

Calcium release-activated calcium channel protein 1

226 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.

Belongs to the Orai family.

25.13 kDa

MSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDAEHDYPRGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKNPLDPAENSNSSITSGQAAAIASTSIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFAWLQDQLDHRGDAISPAVTHFA

orai1

Calcium release-activated calcium channel protein 1

222 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.

Belongs to the Orai family.

24.633 kDa

MKMSRSEHSLQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTNHDYPPGLLIAFSACTTVLVAVHLFALMVSTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAGVVLLCWVKFLPIKPKGQKNGTVSAGVAAAITSTSIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELEELEDLQNELDHREEVSTLQSPGSLYP

orai1

Calcium release-activated calcium channel protein 1

222 amino acids

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.

Belongs to the Orai family.

24.633 kDa

MKMSRSEHSLQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTNHDYPPGLLIAFSACTTVLVAVHLFALMVSTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAGVVLLCWVKFLPIKPKGQKNGTVSAGVAAAITSTSIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELEELEDLQNELDHREEVSTLQSPGSLYP