OPN1SW

Short-wave-sensitive opsin 1

349 amino acids

Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (By similarity). Involved in ensuring correct abundance and localization of retinal membrane proteins (By similarity). May increase spectral sensitivity in dim light (By similarity).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

39.302 kDa

MSKMSEEEEFLLFKNISLVGPWDGPQYHLAPVWAFHLQAVFMGFVFFVGTPLNATVLVATLRYRKLRQPLNYILVNVSLGGFIYCIFSVFIVFITSCYGYFVFGRHVCALEAFLGCTAGLVTGWSLAFLAFERYIIICKPFGNFRFSSKHALMVVVATWTIGIGVSIPPFFGWSRFVPEGLQCSCGPDWYTVGTKYYSEYYTWFLFIFCYIVPLSLICFSYSQLLGALRAVAAQQQESASTQKAEREVSHMVVVMVGSFCLCYTPYAALAMYIVNNRNHGVDLRLVTIPAFFSKSACVYNPIIYCFMNKQFRACIMEMVCGKPMTDESELSSSQKTEVSTVSSSQVGPN

OPN1SW

Short-wave-sensitive opsin 1

349 amino acids

Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (By similarity). Involved in ensuring correct abundance and localization of retinal membrane proteins (By similarity). May increase spectral sensitivity in dim light (By similarity).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

39.123 kDa

MSKMPEEEEFYLFKNISSVGPWDGPQYHIAPVWAFQLQAAFMGIVFLAGLPLNSMVLVATVRYKKLRHPLNYVLVNVSVGGFLLCIFSVLPVFVNSCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALMVVLTTWTIGIGVSIPPFFGWSRYIAEGLQCSCGPDWYTVGTKYRSEYYTWFLFIFCFIVPLSLICFSYAQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAALAMYMVNNRNHGLDLRLVSIPAFFSKSSCIYNPIIYCFMNKQFRACIMEMVCGKAMTDESDISSSQKTEVSTVSSSQVGPN

OPN1SW

Short-wave-sensitive opsin 1

348 amino acids

Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (Probable). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (By similarity). Involved in ensuring correct abundance and localization of retinal membrane proteins (By similarity). May increase spectral sensitivity in dim light (By similarity).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

39.135 kDa

MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

OPN1SW

Short-wave-sensitive opsin 1

348 amino acids

Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (By similarity). Involved in ensuring correct abundance and localization of retinal membrane proteins (By similarity). May increase spectral sensitivity in dim light (By similarity).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

39.135 kDa

MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

OPN1SW

Short-wave-sensitive opsin 1

348 amino acids

Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (By similarity). Involved in ensuring correct abundance and localization of retinal membrane proteins (By similarity). May increase spectral sensitivity in dim light (By similarity).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

39.135 kDa

MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

Opn1sw

Short-wave-sensitive opsin 1

346 amino acids

Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (PubMed:21219924, PubMed:25416279). Involved in ensuring correct abundance and localization of retinal membrane proteins (PubMed:25416279). May increase spectral sensitivity in dim light (PubMed:11055434).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

38.922 kDa

MSGEDDFYLFQNISSVGPWDGPQYHLAPVWAFRLQAAFMGFVFFVGTPLNAIVLVATLHYKKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTGWSLAFLAFERYVVICKPFGSIRFNSKHALMVVLATWIIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESATTQKAEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLDLRLVTIPAFFSKSSCVYNPIIYCFMNKQFRACILEMVCRKPMADESDVSGSQKTEVSTVSSSKVGPH

Opn1sw

Short-wave-sensitive opsin 1

346 amino acids

Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal (By similarity). Required for the maintenance of cone outer segment organization in the ventral retina, but not essential for the maintenance of functioning cone photoreceptors (By similarity). Involved in ensuring correct abundance and localization of retinal membrane proteins (By similarity). May increase spectral sensitivity in dim light (By similarity).

Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

39.062 kDa

MSGEDEFYLFQNISSVGPWDGPQYHIAPVWAFHLQAAFMGFVFFAGTPLNATVLVATLHYKKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTGWSLAFLAFERYLVICKPFGNIRFNSKHALTVVLITWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSEHYTWFLFIFCFIIPLSLICFSYFQLLRTLRAVAAQQQESATTQKAEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLYLRLVTIPAFFSKSSCVYNPIIYCFMNKQFRACILEMVCRKPMTDESDMSGSQKTEVSTVSSSKVGPH