Protein
ATP synthase subunit 9, mitochondrial
Organism
Yarrowia lipolytica (strain CLIB 122 / E 150)
Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed:25759169). F-type ATP synthases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk (PubMed:27373333). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (PubMed:27373333). Part of the complex F(0) domain. A homomeric c-ring of 10 OLI1/ATP9 subunits is part of the complex rotary element (PubMed:27373333).
Similarity
Belongs to the ATPase C chain family.
Sequence
MQLVLAGKYIGAGLASIGLVGAGIGIAIVFAALINGVSRNPALKGQLFTYSILGFALSEATGLFALMIAFLLLYAV