OLAH

S-acyl fatty acid synthase thioesterase, medium chain

265 amino acids

Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).

Belongs to the thioesterase family.

29.931 kDa

MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF

Olah

S-acyl fatty acid synthase thioesterase, medium chain

265 amino acids

Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).

Belongs to the thioesterase family.

30.25 kDa

METAVYAKSTRNEKVLNCLCQKPDALFKLICFPWAGGGSTHFAKWGRKINGLLEVHAVRLAGRETRFEEPFSNDIYQIAEEVVTALLPIIRDKAFAFFGHSFGSYIAFITALHLKEKYKMEPLHIFVSSASAPHSEFRPQVPDINKLSEEQIRDHLLIFGGTPKHLIEDQDFLKQCIPLLKADVDIVKKFIFDKPSKALLSRDITCFIGSEDVVKDIEGWKDITSGKFDVLKLPGDHFYLMEPNNEDFIKNYIVKCLELSSLDYF

Olah

S-acyl fatty acid synthase thioesterase, medium chain

263 amino acids

Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).

Belongs to the thioesterase family.

29.471 kDa

METAVNAKSPRNEKVLNCLYQNPDAVFKLICFPWAGGGSIHFAKWGQKINDSLEVHAVRLAGRETRLGEPFANDIYQIADEIVTALLPIIQDKAFAFFGHSFGSYIALITALLLKEKYKMEPLHIFVSGASAPHSTSRPQVPDLNELTEEQVRHHLLDFGGTPKHLIEDQDVLRMFIPLLKADAGVVKKFIFDKPSKALLSLDITGFLGSEDTIKDIEGWQDLTSGKFDVHMLPGDHFYLMKPDNENFIKNYIAKCLELSSLT