Function
May modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769).
Sequence
MIKAMALSSAGVVSHLHPPSFSSSSGLSVNRVLFRNRNASPCGLSLPILNPSRSVLVFARGKNRKGFVSSSSSSPKKNKKKSLDGADNGGGEEEEDPFEALFNLLEEDLKNDNSDDEEISEEELEALADELARALGVGDDVDDIDLFGSVTGDVDVDVDNDDDDNDDDDNDDDDDDSEEDERPTKLKNWQLKRLAYALKAGRRKTSIKNLAAEVCLDRAYVLELLRDPPPKLLMLSATLPDEKPPVAAPENSSPDPSPVESLSAEDVVVEPKEKVKDEAVHVMQQRWSAQKRVKKAHIETLEKVYRRSKRPTNAVVSSIVQVTNLPRKRVLKWFEDKRAEDGVPDKRAPYQAPV