OAZ1

Ornithine decarboxylase antizyme

292 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis in response to increased intracellular polyamine levels (PubMed:15538383). Binds to ODC/SPE1 monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome (PubMed:18089576).

Belongs to the ODC antizyme family.

34.045 kDa

MYEVIQKRKTKIINVLQSPELMRLIEDPSNLGISLHFPVSSLLKSNKCTPMPKLSTYSLASGGFKDWCADIPLDVPPEIDIIDFYWDVILCMESQFILDYNVPSKNKGNNQKSVAKLLKNKLVNDMKTTLKRLIYNENTKQYKNNNSHDGYNWRKLGSQYFILYLPLFTQELIWCKLNENYFHVVLPSLLNSRNVHDNHSTYINKDWLLALLELTSNLNQNFKFEYMKLRLYILRDDLINNGLDLLKNLNWVGGKLIKNEDREVLLNSTDLATDSISHLLGDENFVILEFEC

OAZ1

Ornithine decarboxylase antizyme

255 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome.

Belongs to the ODC antizyme family.

29.498 kDa

MMEQLRKKEQHIAKVVGECSTQGAVSVSFSTVQLAKGTCLEKLRPWMLRYRCSSRTGYAEWLADRAGAQSVRMAELLELYWDLIAVVEARFAVVPSEVEEERFYRRFQAHVVRRVGRRITCTARGRACAEDKYPDFQQIGDMYGAVGDEQGVHLYKWVQSSRRLLVLMDERAAGRVDLKRWLVMMMELVDGARMLRGCQALQVYVSREDLVNVKDLLKNLNWIGGELVQNVGDRWSDDEAMVWSDERYVVIRFDC

OAZ1

Ornithine decarboxylase antizyme

255 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome.

Belongs to the ODC antizyme family.

29.846 kDa

MEKKVSHVIDFLSNDEVQRQLGDPSISGISFSFDIRTLLKKHSGGNPQFFNYSMRDSFHEWCADIELGANTNELVTELLWDIIYLTEHQFLLPYYHGEHKKFQKKLVKRVGNHLNSLVNNSASKPTGSMTVNVRHVWRNVGDRYTLLYLPLYFKELIWCKANGSIFHVIIPHTKEHVIHEHKEWLLAILEMAGYWNLSHVRLYLPRDDLTNIQTLLKNLHWIGANLLPNENRNECNENDDITLSDETYIILECEC

OAZ1

Ornithine decarboxylase antizyme 1

228 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome (PubMed:17900240, PubMed:26305948, PubMed:26443277). Triggers ODC degradation by inducing the exposure of a cryptic proteasome-interacting surface of ODC (PubMed:26305948). Stabilizes AZIN2 by interfering with its ubiquitination (PubMed:17900240). Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Involved in the translocation of AZIN2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol (PubMed:12097147).

Belongs to the ODC antizyme family.

25.406 kDa

MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNPGPGPRWCSDAPHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGEEEE

OAZ1

Ornithine decarboxylase antizyme 1

227 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome. Triggers ODC degradation by inducing the exposure of a cryptic proteasome-interacting surface of ODC. Stabilizes AZIN2 by interfering with its ubiquitination. Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Involved in the translocation of AZIN2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol.

Belongs to the ODC antizyme family.

25.448 kDa

MVKSSLQRILNSHCFAREKEGDKPSATVHATRTMPLLSLHSRGGRSSESSRVSINCCSNLGPGPRWCSDVPHPPLKIPGGRGNSQRDHNLSANLFYSDNRLNVTEELTSNNKTRIFNVQSRLTEAKHINWRAVLSNSCLYVEIPGGALPEGSKDSFAVLLEFAEEQLHVDHVFICFHKNRDDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGEEE

Oaz1

Ornithine decarboxylase antizyme 1

227 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome (PubMed:16916800, PubMed:18508777). Triggers ODC degradation by inducing the exposure of a cryptic proteasome-interacting surface of ODC (By similarity). Stabilizes AZIN2 by interfering with its ubiquitination (PubMed:18062773). Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Involved in the translocation of AZIN2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol (PubMed:19449338).

Belongs to the ODC antizyme family.

25.133 kDa

MVKSSLQRILNSHCFAREKEGDKRSATLHASRTMPLLSQHSRGGCSSESSRVALNCCSNLGPGPRWCSDVPHPPLKIPGGRGNSQRDHSLSASILYSDERLNVTEEPTSNDKTRVLSIQSTLTEAKQVTWRAVWSGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLQADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLEREDPGEED

Oaz1

Ornithine decarboxylase antizyme 1

227 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome. Triggers ODC degradation by inducing the exposure of a cryptic proteasome-interacting surface of ODC. Stabilizes AZIN2 by interfering with its ubiquitination (By similarity). Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter (PubMed:8166639). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Involved in the translocation of AZIN2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol (By similarity).

Belongs to the ODC antizyme family.

25.228 kDa

MVKSSLQRILNSHCFAREKEGDKRSATLHASRTMPLLSQHSRGGCSSESSRVALHCCSNLGPGPRWCSDVPHPPLKIPGGRGNSQRDHSLSASILYSDERLNVTEEPTSNDKTRVLSIQCTLTEAKQVTWRAVWNGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLRADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLEREDPGEED

OAZ1

Ornithine decarboxylase antizyme 1

222 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome. Triggers ODC degradation by inducing the exposure of a cryptic proteasome-interacting surface of ODC. Stabilizes AZIN2 by interfering with its ubiquitination. Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Involved in the translocation of AZIN2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol.

Belongs to the ODC antizyme family.

24.675 kDa

MVKSSLQRILNSHCFAREKEGDKRSATLHASRTMPLLSQHSRGGCSSESSRAALHCCSNLGPGPRWCSYVPHPPLKIPGGRGNSQRDHSLSASVLYSDERLNVTEEPTANDKTRVLSIQSRLTEAKQVTWRAVWNGGGLYIELPAGPSPEGSKDSFAALLEFAEEQLQADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLERED

oaz1

Ornithine decarboxylase antizyme 1

216 amino acids

Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome.

Belongs to the ODC antizyme family.

24.414 kDa

MVKSSLQRILNSHCFAREKEGNKRNDAMPLLSIPSSSESSRASFNCCSNLGPGPRWCSDVPHPPLKIPGGRGNSQRDHNLSANLFYSDNRLNITEELTSNNRTRILNVQSSLTDGKQVSWRAVLNNNNLYIEIPSGTLPDGSKDSFAILLEYAEEQLQVDHVFICFHKNRDDRAMLLRTFRFLGFEIVIPGHPLVPKRPDACFMAYTFERDSSDED