Nupr2

Nuclear protein 2

102 amino acids

Acts as a transcriptional repressor by inhibiting gene expression at the NUPR1 promoter in a p53/TP53-dependent manner in cancer cells. Involved in the G1 cell cycle arrest, and in a decrease in cell viability and cell proliferation of pancreatic cancer cells. Plays a role as a negative regulator of the protumoral factor NUPR1.

Belongs to the NUPR family.

11.767 kDa

MDPPTRPSVSGPRTRARPPPPEALPTVGFEEEVYDCLDYYYLRDFPASGAGRSKGRTRREQQLRTNYPVPGGHERKVAQILLNGQRKRRQRQLQPRPRTRLA

NUPR2

Nuclear protein 2

98 amino acids

Acts as a transcriptional repressor by inhibiting gene expression at the NUPR1 promoter in a p53/TP53-dependent manner in cancer cells. Involved in the G1 cell cycle arrest, and in a decrease in cell viability and cell proliferation. Plays a role as a negative regulator of the protumoral factor NUPR1.

Belongs to the NUPR family.

11.522 kDa

MEPAAPTVQPRAQPPPPDVWPPVGSEEEFYDCPDYYYLRDFPACGAGRINGRTRRERELRTNWLVPGGHERKIAQKLLNSQRKRRQRQLQPRPRTRLT

NUPR2

Nuclear protein 2

97 amino acids

Acts as a transcriptional repressor by inhibiting gene expression at the NUPR1 promoter in a p53/TP53-dependent manner in cancer cells (PubMed:25899918). Involved in the G1 cell cycle arrest, and in a decrease in cell viability and cell proliferation (PubMed:25899918). Plays a role as a negative regulator of the protumoral factor NUPR1 (PubMed:25899918).

Belongs to the NUPR family.

11.356 kDa

MEAPAERALPRLQALARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRTNWPAPGGHERKVAQKLLNGQRKRRQRQLHPKMRTRLT