Nup35

Nucleoporin Nup35

331 amino acids

Functions as a component of the nuclear pore complex (NPC) (By similarity). May have a role in the organization of the inner nuclear membrane proteins at the nuclear envelope together with Nup154 (PubMed:22718353).

Belongs to the Nup35 family.

35.099 kDa

MEPMNLGSPVNSPGSNQTQYLPPFLLGDPQGITPHKNTLSPKTGRSNISFATSPGGSSPHELNRSALSTRTLFAAQGGAHTAVGANSSTTAHGQTHSHHQTGPPTQGLFDSLREQSVTPKKKNHLGMLQLQSPNQSYQSSYHTNDSFAPGAPNAINASMRALCSPLGATASPAGGLGTSVTTGGNSRLSDFWVTIFGFPPGAGSMVLQHFTVCGTIVDVVHAPQNGNWMYVRYSSRIESDKALNYNEKIIAGNVMVGVSRCTDRSVIDKENIGSVPNAEIGDPPTSPSAIRPFSQQSYKLARKDNIISPQKDVPQKSSGLMDKAMDLIFGW

nup35

Nucleoporin NUP35

330 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors (By similarity).

Belongs to the Nup35 family.

35.227 kDa

MAAFSMEPMGAEPMALGSPTSPKPSAGAQFLPGFLLGDIPTPVTPQQRPSIGVMEMRSPLLSGGSPPQPVVPTHKDKSGAPPVRSIYDDIASPGLGSTPLNPRKTASFSVLHTPLSGVIPSSPECKNISGSRKRPASSVFSPATIGHSRKTTLSPAQMDPFYTQGDALTSDDQLDDTWVTVFGFPQASASYILLQFAQYGNIIKHVMSNNGNWMHIQYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMEATEKVSTPTVSSVFTPPVKNIGTPTQSVGTPRAASMRPLAATYKTPASADYQVVADKQAPRKDESIVSKAMEYMFGW

NUP35

Nuclear pore complex protein NUP35

329 amino acids

Belongs to the Nup35 family.

35.43 kDa

MSAAAHRTPKSGRQSLLFQDLASPVSARRGKFSSPGQAAAVSALWRENFGGSDLPPPPMYTLDDRSDFSPESGIADYSASPDAKSDRRTPFQSSGKNIVTPGKGKLEASPSFSLLNAQQSQQVSGSPSWWSQSKAGSSTEQDDKGKGSPVEGVVQPGALVTLPPPREVARPEVQRQIIPTGNLDEEEWVTVYGFSPGDTNLVLREFEKCGMVLKHVPGPRNANWMHILYQNRSDAHKALNKAGMMINGVVIVGVKPVDPIQKQALNERLNNQGFMPLPPPSSTRNTARPLSRPQYLQNGSAFSPQPSGGAMASPSKSMVSKFFDLMFGV

NUP35

Nucleoporin NUP35

326 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC.

Belongs to the Nup35 family.

34.774 kDa

MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW

Nup35

Nucleoporin NUP35

325 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC (By similarity).

Belongs to the Nup35 family.

34.786 kDa

MAAFAVDPQAPTLGSEPMMLGSPTSPKTGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISLLQSPLVGATTPVPGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKNVMENSDRGVLSSPSLAFTTPIRTLGTPTQSGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAMEYMFGW

Nup35

Nucleoporin NUP35

325 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC (By similarity).

Belongs to the Nup35 family.

34.802 kDa

MAAFAVDPQAPTLGSEPMMLGSPTSPKPGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLPSRRQANISVLQSPLVGVTTPVTGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKNVMENSDRGVLSSPSLAFTPPIRTLGTPTQPGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAMEYMFGW

nup35

Nucleoporin NUP35

308 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors (By similarity).

Belongs to the Nup35 family.

32.885 kDa

MEIQSCIEPMTLGSPTSPKPGAQFLPGFLMGDLPAPVTPQPRSFGLTGGAEIRSPLLAGGSPPQPVVPTPKDKSGAPPVRSIYDDLNGSAVGMSPLAARKQPFAGVHTPLSGLQGTPGTVSNFFSPVSQQRKTTLSPAQVDPFFTQGDALSSEDQLDDTWITVFGFPPASASYILLQFAQYGNILKHVMSNTGNWMHVQYQSKLQARKALSKDGKIFGEAIMIGVKPCIDKSVMESLDKGSTSSSVFTPPVKAPCTPSHPLSTPRSVMRPLSAAYKASSSDYQVVSDQQTPKKDESFVSKAMEYMFGW