NUDT3

Nudix hydrolase 3

772 amino acids

Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Belongs to the Nudix hydrolase family.

86.857 kDa

MAEEHFDVLTKSGEKTGVSKPRGEVHRDGDYHRAVHVWIFVETTQQLLLQLRSDDKDSWPGQWDISSAGHISAGDTSLLSAQRELEEELGVKLPKDAFEKIFVFLQECVTNDGKFINNEFNDVYLVTILHPIPLEAFTLQKEEVSAVKYVPYEEYRNFLSKEDPAYVPYDVNGEYGKLFDIIRQRCQVNTEARSLSLQKQLQRYSPVTLEAKLTELSEADQKALGLIVKAAKIMDDIFYEQVWNSNPALRDWLKDHANASKLDKLKWDYFTINKSPWSSLDENEAFLSTADSAVKLLPGATKAIAGWKGLEYRAAFPVTKPPGANFYPPDMDKMEFTLWLNGLTEEQKHAATGFFSVIKRRSEANLDASDHLASSTKKLPDSNSDLYSIPYSEIYRPFLKKASEFLQKAGDLVSSPSLKKLLHSKAEAFLSNEYYESDIAWMDLDSKLDITIGPYETYEDEIFGYKATFETFIGIRDDKATADLKLFGDNLKLLEDNLPLESVYKSTDVSAAPIRVIQLIYNSGDVKGPQTVAYNLPNDEKIVKDRGTSMVMLKNVQEAKFEHILKPIAEITISKEQRGLVDFDSFFTHTICHECCHGIGPHTITLPGGQTSTVRKELQEVHSAMEEAKADIVGLWALKFLITKGLLSKSMVESMYVSFLAGCFRSIRFGLTEAHGKGQALQFNYLYEKGAFVFHEDSTFSVDFAKIEGAVESLSHEILTIQGKGDKNAATLLLNKYCTITGPLKTALENLERVKVPVDISPTFPLAEALMN

NUDT3

Diphosphoinositol polyphosphate phosphohydrolase 1

172 amino acids

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphosphate) is not a substrate. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate (By similarity).

Belongs to the Nudix hydrolase family. DIPP subfamily.

19.362 kDa

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPGTAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVSIGRKREWFKIEDAINVLQCHKPVQASYFETLRQGYSANNGTPLVAPTYSVSAQSSMPGIR

NUDT3

Diphosphoinositol polyphosphate phosphohydrolase 1

172 amino acids

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphosphate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.

Belongs to the Nudix hydrolase family. DIPP subfamily.

19.471 kDa

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

Nudt3

Diphosphoinositol polyphosphate phosphohydrolase 1

168 amino acids

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphosphate) is not a substrate. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate (By similarity). Acts as a negative regulator of the ERK1/2 pathway.

Belongs to the Nudix hydrolase family. DIPP subfamily.

19.03 kDa

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQCHKPVQASYFETLRQGYPANNGTPVVPTTYSSSVSGIR

Nudt3

Diphosphoinositol polyphosphate phosphohydrolase 1

168 amino acids

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphosphate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.

Belongs to the Nudix hydrolase family. DIPP subfamily.

19.096 kDa

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEEAVKVLQYHKPVQASYFEALRQGYSANNGTPVLPTTYSSSMSGIR