NPPA

Natriuretic peptides A

152 amino acids

Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3 (By similarity).

Belongs to the natriuretic peptide family.

16.368 kDa

MGSSAITTSFLLFVAFQLPGQTGANPVYGSVSNADLMDFKNLLDRLEDKMPLEDEAVPSQVLSEQNEEAGAPLSPLSEVPPWDGGRSTQPREMGAPSDGDPGNPPRSVLLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR

nppa

Natriuretic peptides A

139 amino acids

Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Has a cGMP-stimulating activity (By similarity).

Belongs to the natriuretic peptide family.

15.569 kDa

MTALVLWGLLLLLGQHTQVNSHVLGRPFSASDSSQLKSLLERLEETISEADQEQNPELDQEVEYDIRDQDPGQRWNLDLGRDQDQVTATRSEIHSRPSVQRSHLQDLLMSLRKRASSCFGARMDRIGNASGLGCNNGRG