NPFF

Pro-FMRFamide-related neuropeptide FF

115 amino acids

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. The neuropeptide FF potentiates and sensitizes ASIC3 cation channel.

Belongs to the FARP (FMRFamide related peptide) family.

12.614 kDa

MDARQAAALLLVLLLVTDWSHAEGPGGRDGGDQIFMEEDSGAHPAQDAQTPRSLLRSLLQAMQRPGRSPAFLFQPQRFGRNTRGSWSNKRLSPRAGEGLSSPFWSLAAPQRFGKK

Npff

Pro-FMRFamide-related neuropeptide FF

114 amino acids

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.

Belongs to the FARP (FMRFamide related peptide) family.

13.012 kDa

MDSKWAALLLLLLLLLNWGHTEEAGSWGEDQVFAGEDKGPHPPQYAHIPDRIQTPGSLFRVLLQAMDTPRRSPAFLFQPQRFGRSAWGSWSKEQLNPQARQFWSLAAPQRFGKK

Npff

Pro-FMRFamide-related neuropeptide FF

114 amino acids

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF and SF potentiate and sensitize ASIC2 and ASIC3 channels.

Belongs to the FARP (FMRFamide related peptide) family.

13.152 kDa

MDSKWAAVLLLLLLLRNWGHAEEAGSWGEDQVFAEEDKGPHPSQYAHTPDRIQTPGSLMRVLLQAMERPRRNPAFLFQPQRFGRNAWGPWSKEQLSPQAREFWSLAAPQRFGKK

NPFF

Pro-FMRFamide-related neuropeptide FF

113 amino acids

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.

Belongs to the FARP (FMRFamide related peptide) family.

12.44 kDa

MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK