NPBWR1

Neuropeptides B/W receptor type 1

331 amino acids

Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals (By similarity).

Belongs to the G-protein coupled receptor 1 family.

36.268 kDa

MHNASYWGPERANTSCPAPAPTLGCPNASGPAPPLPPPLAVAVPVVYAVICAVGLAGNSAVLFVLLRAPRRKTVTNLFILNLAVADELFTLVPPVNIADFLLRRWPFGELLCKLVVAVDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYGAARAVSLAVWGVATLVVLPFAVFARLDEEQGRRQCVLVFPQPEALWWRASRLYTLVLGFAIPVSTICVLYTSLLCRLRAIRLDSHAKALDRAKKRVTVLVVAILAVCLLVWTPYHLSTVVALTTDLPQTPLVIAVSYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLLACRTTS

Npbwr1

Neuropeptides B/W receptor type 1

329 amino acids

Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals (By similarity).

Belongs to the G-protein coupled receptor 1 family.

36.076 kDa

MHNLTLFESGGDNVSCGGSSLGCPNGSSLAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVTTICALYTTLLCRLRAIQLDSHAKALDRAKKRVTLLVAAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSCRSA

Npbwr1

Neuropeptides B/W receptor type 1

329 amino acids

Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals (By similarity).

Belongs to the G-protein coupled receptor 1 family.

36.306 kDa

MHNLSLFEPGRGNVSCGGPFLGCPNESNPAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICALYITLLCRLRAIQLDSHAKALDRAKKRVTLLVVAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSCRTA

NPBWR1

Neuropeptides B/W receptor type 1

328 amino acids

Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals. Has a higher affinity for neuropeptide B.

Belongs to the G-protein coupled receptor 1 family.

36.103 kDa

MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA