nosip

Nitric oxide synthase-interacting protein homolog

333 amino acids

Regulates nitric oxide production.

Belongs to the NOSIP family.

37.764 kDa

MPRHSKHSCSNSGKFSNYERQLLKYGTTTERLGKDSIKNFDSCSLCLNDVIMPVICNKGHLYCKECILTSLIDQKKLIKIKEKEWEQYQNKLKYEQDQKQEKQHQDSIKEFEKNVITLEGIGSNDDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTTTTTTSDVNNKDKEKKEIVEKEIKLNSYWVITPDNKDKAIEKPRSYTVCPADGKHPLKSAQLINVHFTNVKPSSSDSNDSNNQYCCPICSKVLSNSTKTRLLKRCGHVFCSCLDKFKEDSSSQLSCYVCDKPYTEDEIIQIHSGGTGFSGSGSNLEAKKYTHTAIV

nosip

Nitric oxide synthase-interacting protein

304 amino acids

E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face (By similarity). Negatively regulates nitric oxide production by inducing nitric oxide synthase translocation to actin cytoskeleton and inhibiting its enzymatic activity (By similarity).

Belongs to the NOSIP family.

33.332 kDa

MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTEDGYLYEKEAILQYILHQKTEIAKKMKAYEKQKQALKSEGQLESKSEERERAEKFKQRENNIVSKPINPFTSGKSKDEGNQNGSTSSSSTDTSSGESSSSSALPSFWIPSLTPEAKPTLLKKPSKTVSCPMSGRPLKMSDLITVRFTPLDPSLDRVALLTRQDRYVCAVTKDTLGNSVPCAVLRPSGVVVTMECVEKLIKKDMVDPITGDKLKEKDIIPIQRGGTGFAGSGVDLKAKEARPVMQA

NOSIP

Nitric oxide synthase-interacting protein

302 amino acids

E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face. Catalyzes monoubiquitination of serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB (By similarity). Negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity (By similarity).

Belongs to the NOSIP family.

33.043 kDa

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGARREEQKELQRAAAQDHVRGFLEKEAAIVSRPLNPFTPKAASAGNGPDDAQPGSSAGPAGKDKDKALPSFWIPSLTPEAKATKLEKPSRIVTCPMSGKPLRMSDLTPVRFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGEKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

NOSIP

Nitric oxide synthase-interacting protein

301 amino acids

E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face. Catalyzes monoubiquitination of serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB (By similarity). Negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity (PubMed:11149895, PubMed:15548660, PubMed:16135813).

Belongs to the NOSIP family.

33.172 kDa

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

NOSIP

Nitric oxide synthase-interacting protein

301 amino acids

E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face. Catalyzes monoubiquitination of serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB (By similarity). Negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity (By similarity).

Belongs to the NOSIP family.

33.143 kDa

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDNAQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

Nosip

Nitric oxide synthase-interacting protein

301 amino acids

E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye and the face. Catalyzes monoubiquitination of serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB (PubMed:25546391). Negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity (By similarity).

Belongs to the NOSIP family.

33.209 kDa

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVNGDTLTERDIIVLQRGGTGFAGSGVKLQAEMSRPVMQA

nosip

Nitric oxide synthase-interacting protein

298 amino acids

E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face (By similarity). Negatively regulates nitric oxide production by inducing nitric oxide synthase translocation to actin cytoskeleton and inhibiting its enzymatic activity (By similarity).

Belongs to the NOSIP family.

33.304 kDa

MTRHGKNCTAGAVYTYYEKKKDTVASGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVTSDGYIYEKESILEYILHQKKEIARQMKAYEKQKNSKKAEMEELNKAAKESKMKAFLDKEMTIVSKPLNPFTRKSDSGIDAAEPSCSQQSSEEKNKQLPSFWIPSLTPEAKTSLVKKPDKTVYCPMSGRPLKMKDLMPVNFTRVDEKVDRVGLINRQDRYVCAVTRDMLGNSVPCAVLRPSGAVVTMECVEKLIKKDMIDPISGDKLSERDIIMLQRGGTGFSGSGVLLQAKEARPVMQA

nosip

Nitric oxide synthase-interacting protein

298 amino acids

E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face (By similarity). Negatively regulates nitric oxide production by inducing nitric oxide synthase translocation to actin cytoskeleton and inhibiting its enzymatic activity (By similarity).

Belongs to the NOSIP family.

33.042 kDa

MTRHGKNCTAGAVYTYYEKKKDTAASGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVTSDGYIYEKEAILEYILHQKKEIARQMKAYDKQKNAKKAEMDELNKAAKESQMKAFLDKEMTIVSKPLNPFTRKSDSGADTAEPSGSQQSSEEKGKQLPSFWIPSLTPEAKTSLVKKPDKTVYCPMSGKPLKMKDLIPVHFTAVDEKVDRVGLINRQDRYVCAVTRDMLGNSVPCAVLRPSGAVVTMECVEKLIKKDMIDPISGDKLHERDIIMLQRGGTGFSGSGVLLQAKEARPVMQA