NMRK2

Nicotinamide riboside kinase 2

230 amino acids

Catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). Reduces laminin matrix deposition and cell adhesion to laminin, but not to fibronectin. Involved in the regulation of PXN at the protein level and of PXN tyrosine phosphorylation. May play a role in the regulation of terminal myogenesis.

Belongs to the uridine kinase family. NRK subfamily.

26.046 kDa

MKLIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESLDMEAMLDTVQAWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKYRQEMEANGVEVVYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM

Nmrk2

Nicotinamide riboside kinase 2

195 amino acids

Catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). Reduces laminin matrix deposition and cell adhesion to laminin, but not to fibronectin. Involved in the regulation of PXN at the protein level and of PXN tyrosine phosphorylation. May play a role in the regulation of terminal myogenesis (By similarity).

Belongs to the uridine kinase family. NRK subfamily.

22.375 kDa

MKLIIGIGGVTNGGKTTLTNSLLKALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESLDMETMLSTVQAWVKDPHKFARAHGVSLQSGASDTHVLLLEGFLLYSYRPLVDLYSQRYFLTVPYEECKRRRRSRTYMVPDPPGLFDGHVWPMYQKYRREMEQDGVEVVYLDGMKSPEGLFHQVLEDIQNRLLNTS