Nfkbid

NF-kappa-B inhibitor delta

327 amino acids

Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses (PubMed:11931770, PubMed:15749903, PubMed:16410444, PubMed:16413922, PubMed:17641034). Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR) (PubMed:25282160). According to PubMed:11931770, it may also regulate TCR-induced negative selection of thymocytes (PubMed:11931770).

Belongs to the NF-kappa-B inhibitor family.

34.942 kDa

MEDSLDTRLYPEPSLSQVGSWRVSSLPSGSPQLPSPTGPSLETARAHILALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQMYRQLDIREHKGKTPLLVAAAANQPLIVEDLLSLGAEPNATDHQGRSVLHVAATYGLPGVLSAVFKSGIQVDLEARDFEGLTPLHTAVLALNAAMLPASVCPRMQNSQARDRLTCVQMLLQMGASHTSQEIKSNKTILHLAVQAANPTLVQLLLGLPRGDLRAFVNMKAHGNTALHMAAALPPGPPQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRTAPPGLSS

NFKBID

NF-kappa-B inhibitor delta

313 amino acids

Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR). May also regulate TCR-induced negative selection of thymocytes.

Belongs to the NF-kappa-B inhibitor family.

33.481 kDa

MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS