NECAB3

N-terminal EF-hand calcium-binding protein 3

396 amino acids

Inhibits the interaction of APBA2 with amyloid-beta precursor protein (APP), and hence allows formation of amyloid-beta. May enhance the activity of HIF1A and thus promote glycolysis under normoxic conditions; the function requires its ABM domain and may implicate the stabilization of the interaction between HIF1AN and APBA3.

44.35 kDa

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN

NECAB3

N-terminal EF-hand calcium-binding protein 3

358 amino acids

Inhibits the interaction of APBA2 with amyloid-beta precursor protein (APP), and hence allows formation of amyloid-beta (By similarity). May enhance the activity of HIF1A and thus promote glycolysis under normoxic conditions; the function requires its ABM domain and may implicate the stabilization of the interaction between HIF1AN and APBA3 (By similarity).

40.154 kDa

MACAGLLTVCLIRPPAPEPPRPPAPAPAAGPAGHALFQDVFRRADKNDDGKLSFEEFQNYFADGVLSPGELRELFSGVDGHPADNLETEKLCDYFSEHLGVYRPVLAALESLNCAVLTAMDTTKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAQGPRSDEERVEVPSRPRGSRWAGRRALRSVSRSSTWSPGSSNTGQSSEAEMQWRLQINRLQELIDQLECKAPRLEPLHEEELTKGPSSHILVAQRQVQVAEEALQDFHHALCCYVDFTGSQSHCLHVSAQKMLDKASFTLYEFWQDEASWRRHQQSACSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN

Necab3

N-terminal EF-hand calcium-binding protein 3

353 amino acids

Inhibits the interaction of APBA2 with amyloid-beta precursor protein (APP), and hence allows formation of amyloid-beta (By similarity). May enhance the activity of HIF1A and thus promote glycolysis under normoxic conditions; the function requires its ABM domain and may implicate the stabilization of the interaction between HIF1AN and APBA3 (By similarity).

39.906 kDa

MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDGKLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAALESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLEAQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQVNRLQELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQRQVQVAEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN