ndufs4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

190 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I NDUFS4 subunit family.

21.749 kDa

MLKKFLISSIVKPTFQSRIIASTTLNGGAGRATFCSVNSINPNPTASQIKVDQEDLEVGEHLVIDDPNQQHIKSFLNGVEFNGKSVNIYRPSRNTMQTGTLRTKKWVIELPFNPKWNDRLMGWWASKDTLNQLNLRFNSETDAVAYCKEIGLNYNIVEEDVTLRKKKKYGHRFRYRGDLVGEKEREVGIN

NDUFS4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

19.812 kDa

MAAVSMSVALRQALWGRRVATVAAVSVSKVSTRSLSTSTWRLAQDQTRDTQLITVDEKLDITTITGVPEEHIKTRKARIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNLVLTFSTKEDAVAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK

NDUFS4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I NDUFS4 subunit family.

19.718 kDa

MAAVSMSVALKQALWGRRAAAVGAVSVSKVPTRLLSTSTWRLAQDQTQDTQLIAVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWSSTADPLSNLVLTFSTKEDAVAFAEKNGWSFDVEERKVPKPKSKSYGANFSWNKRTRVSTK

NDUFS4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

20.108 kDa

MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

NDUFS4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

20.108 kDa

MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Ndufs4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

19.785 kDa

MAAVSISVSLRQAMLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPKPKSKSYGANFSWNKRTRVSTK

NDUFS4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

20.072 kDa

MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTXSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

NDUFS4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

20.161 kDa

MAAVSMSVALRQTLWRRRAVAVAALSVSRVPTRLLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFRTKEDAVSFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK

NDUFS4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

20.161 kDa

MAAVSMSVALRQTLWRRRAVAVAALSVSRVPTRLLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFRTKEDAVSFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK

Ndufs4

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

175 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFS4 subunit family.

19.741 kDa

MAAVSMSVSLRQALLRQRAVATAAVSVCRVPSRLLNTSTWKLADGQTRDTQLITVDEKLDVTPLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAVAFAEKHGWSYDVEGRKVPKPKSKSYGANFSWNKRTRVSTK