NDUFA12

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

145 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFA12 subunit family.

17.09 kDa

MELLQVLKRGLQQVSGHGGLRGYLRVLFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTVKPPTARKFIWTNHKFNLSGTPQQYVPYSTTRKKIQEWVPPSTPYK

NDUFA12

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

145 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFA12 subunit family.

17.147 kDa

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNMTGTPEQYVPYSTTRKKIQEWIPPSTPYK

NDUFA12

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

145 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFA12 subunit family.

17.114 kDa

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Ndufa12

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

145 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFA12 subunit family.

17.086 kDa

MELVEVLKRGVQQVTGHGGLRGLLRVFFRANDIRIGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTTNPPTARKFIWTNHKFNVSATPEQYVPYSTTRKKIHEWVPPSTPYK

NDUFA12

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

145 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFA12 subunit family.

17.114 kDa

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

NDUFA12

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

145 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFA12 subunit family.

17.105 kDa

MELVQVLKRGLQRITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHHWLHSITDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

ndufa12

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

138 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I NDUFA12 subunit family.

16.234 kDa

MTEILRYCQGIMQRGIKESIKTLYYTGELKFGTLVGVDKVGNRYYENRQEIYGRHRWVEYGDYKSNDPTTIPPEYHSWIHHVSDKLPSEMLPFSPTYKRPHIANPTGTDGAYTPPNFLFNIEKSKEELQKEEKNDNKQ