ndrg4

Protein NDRG4

405 amino acids

Contributes to the maintenance of intracerebral BDNF levels within the normal range. May enhance growth factor-induced ERK1 and ERK2 phosphorylation. May attenuate growth factor-promoted ELK1 phosphorylation in a microtubule-dependent manner (By similarity).

Belongs to the NDRG family.

44.461 kDa

MKLLGHKIELWAGLLLPDVSISGMSELRFPEEKPLLRGQDTEMESADTFLSAADTDWKEHDIETPYGMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVNIDPNGKGWIDWAASKLSGLTSSLPETVLSHLFSQEELMNNTELVQNYRQQISSCVNQSNLQLFWNMYNSRRDLEMSRPGTVPNAKTLRAPVMLVVGDNAPAEDCVVECNSKLDPTNTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIASLKDRRQSASAGAVPSASMTRLARSRTASLTSASSVDGARPRPCTQSESSDGIGQINHTMEVSC

NDRG4

Protein NDRG4

352 amino acids

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress (By similarity). May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by PDGF and FGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.

Belongs to the NDRG family.

38.459 kDa

MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAYLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC

Ndrg4

Protein NDRG4

352 amino acids

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress. May enhance growth factor-induced ERK1 and ERK2 phosphorylation. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.

Belongs to the NDRG family.

38.509 kDa

MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQISNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEEGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQPCAHSDSSEGMGQVNHTMEVSC

Ndrg4

Protein NDRG4

352 amino acids

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress (By similarity). May enhance growth factor-induced ERK1 and ERK2 phosphorylation, including that induced by NGF. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.

Belongs to the NDRG family.

38.487 kDa

MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTLFNLEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLATMLPNVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQISSVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQPCTHSDSSEGMGQVNHTMEVSC