ndk1

Nucleoside diphosphate kinase

153 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

16.932 kDa

MSNEQTFIAIKPDGVQRGLIGPIISRFENRGFKLVAMKLVSPPQSQLEQHYADLSDKPFFKGLVSYMLSGPICAMVWEGRDVVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSDSVENAKKEIALWFKPEELISWKSATFDWVYEKA

NDK1

Nucleoside diphosphate kinase

151 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity).

Belongs to the NDK family.

17.109 kDa

MSDERTFIAIKPDGVQRGLISQILSRFESRGYKLVGIKLVTPTENLLKQHYAEHVEKPFFPKMLAYMTSGPILATVWEGKDVVKQGRVILGATNPLNSAPGTIRGDFALDMGRNVCHGSDSVESAQREIDLWFKKEELVDWKLNQLSWIYE

ndk1

Nucleoside diphosphate kinase

151 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

17.013 kDa

MSTEQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFYEKLVGFMASGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPGTIRGDYGIDLGRNVCHGSDSIESANREIKLWFQPSEIQVYDRTIEPWIYE

NDK1

Nucleoside diphosphate kinase 1

149 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.

Belongs to the NDK family.

16.5 kDa

MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET

NDK1

Nucleoside diphosphate kinase

147 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity).

Belongs to the NDK family.

16.66 kDa

MERTFIMIKPDAIKRRLISRIIQRFEEKGLYLAASKCVIPKREVLETHYSHLSSMPFFSEMVEDMMSGMVLAMVWVGKDAVSIGRKLIGETNPQAASVGTIRGDYGVSTGKNIIHGSDCVENAEKEIKLWIGDDVQPVSFFDKEWIY

ndk1

Nucleoside diphosphate kinase 1

141 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

15.688 kDa

MASEQTLSIIKPDAVQNNYIGEIISRFEQAGLKIAAIKMTTLTKDQASKFYAIHKDRPFYNDLVNFMSSGPVVVMVLEGNQAIAKNRELMGATDPKKAEKGTLRADFAESMSRNAVHGSDSSETAEEEVLFFFKPDEITHR

NDK1

Nucleoside diphosphate kinase

21 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

2.379 kDa

single

NVCHGSDSVESANKEIDLWFK