ND3

NADH-ubiquinone oxidoreductase chain 3

148 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

17.312 kDa

MLNYFVYPYGIENDIGIKFYMILVPIISIVLIIINYIITNKSDNNINKTGPYECGFDSFRQSRTTYSIKFILIAILFLPFDLELTSILPYTLSIYNLNIYGLFILLYFLLPLIIGFIIEINLKAIYITKIFNRNVKSITSYVKYNNKI

ND3

NADH-ubiquinone oxidoreductase chain 3

143 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

16.621 kDa

MNTITLFFLFIPILAVILLFANLLLAVHRPDSEKVTPYECGFSPVYGQTRNPFSIQFYLVGILFLVFDIEILLTYPYAMNLYQTSTYGFWIFVIFFLVLTVGFVYEFGTGALYFTDKRSSIQNTKISDSKHSPFFWSKSEKRL

ND3

NADH-ubiquinone oxidoreductase chain 3

137 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

15.798 kDa

MSSMTLFILFVSIIALLFLFINLIFAPHNPYQEKYSIFECGFHSFLGQNRTQFGVKFFIFALVYLLLDLEILLTFPFAVSEYVNNIYGLIILLGFITIITIGFVYELGKSALKIDSRQVITMTRFNYSSTIEYLGKI

nd3

NADH-ubiquinone oxidoreductase chain 3

136 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

15.65 kDa

MTTTTFFLFLIPVLAIILLAVNLIFSPHNPYQEKDSAFECGFHSFLGQNRTQFSISFFIFALLFLLFDLEILLVYPYVVSAYTNGIYGLVIMLVFFLVGTLGFAFELGKNALKIESRQVYNFNYKSWSGYSLIYNK

ND3

NADH-ubiquinone oxidoreductase chain 3

131 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.682 kDa

MFTAYLILCPIIAVVLVGLNWLLATSNSYIEKDGPFECGFTSFQQSRSAFSVAFILVAILFLPFDLEISSILPFVISPYSNGLYGLVILVIFLILLIVAFVVEIQLKALQLNRTYTNDLPHTELYDININD

ND3

NADH-ubiquinone oxidoreductase chain 3

128 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.475 kDa

MFTIYTYLAPIVAMVLVVLNYLISNNNSYIEKDGPFECGFTSYQQTRSAFSVAFILVAILFLPFDLEMSSILPYVVSAYSNGTYGLSILVIFLLSLVIAFVYEINLGALNLERRYTPIVKPLMNKLYL

ND3

NADH-ubiquinone oxidoreductase chain 3

128 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I subunit 3 family.

14.47 kDa

MNTFIIFIILIPIVGFALLAVNILLAVYKPYNEKLGAFECGLTSFNQTRLAFNAAFILVAILFLPFDLEISTLLPYVMSIYLVSNYGFTIVLLFLLILIIGFVYEINTNALKINKHNKPNTDSLIYKL

ND3

NADH-ubiquinone oxidoreductase chain 3

121 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.141 kDa

MKLIFTEYSAILIFFAISSLLSSVIFLLSYFLIPQKPDQEKVSAYECGFNPFDDARATFDIRFYLVAILFLIFDLEISFLFPWSLVLGEISIIGFWSMIVFLVILTIGFIYEWYKGALEWE

ND3

NADH-ubiquinone oxidoreductase chain 3

120 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.449 kDa

MGSMTLLFFVEHVFIFCMIFWLLTWVAEYFFKSKNNKQKHQFYECGIRALSELNIQINLNFSIVCVFLILYDVEFIFMYPFFFNFFLVNAGAFLVFFVFLFFVFYSLVYDSVQNSLALQL

ND3

NADH-ubiquinone oxidoreductase chain 3

120 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.218 kDa

MKFYFVEYFILFTYIIISFILACIISLLSYLLTTKKEDPEKTSAYECGFNPFDDTRTTFDVKFYLVAILFFNFCLEISFLFPWSIVLGNISYFGFVAIILFLFILTIGFIYEWKKGALNW

ND3

NADH-ubiquinone oxidoreductase chain 3

119 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.935 kDa

MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

119 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.935 kDa

MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

119 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.935 kDa

MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.228 kDa

MTLEYIYIFIFFWGAFFISCLLIFLSYFLVYQESDIEKNSAYECGFQPFEDTRSKFNVRYYLIAILFMIFDLEIMYLFPWSISISTGSFFGVWAIFLFLIILTVGFIYEWQKGALEWD

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.791 kDa

MSEFSPIFIYLVMSLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.725 kDa

MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.711 kDa

MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILFIGSLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.688 kDa

MEFAPIFVYLVISLLLSLILIGVSFLFASSSSLAYPEKLSAYECGFDPFDDARSRFDIRFYLVSILFIIFDLEVTFLFPWAVSLNKIGLFGFWSMMVFLFILTIGFVYEWKKGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.517 kDa

MYTEFYGILVLLIFSVVLSAIISGASYILGDKQPDREKVSAYECGFDPFGTPGRPFSIRFFLIGILFLIFDLEISFLFPWCVVCNQVFPFGYWTMIVFLAVLTLGLVYEWLKGGLEWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.204 kDa

MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKSSAYECGLDPSGDARSRVDIRFYLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASDRE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.725 kDa

MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.268 kDa

MSEFAPICIYLVISLLVSLIPLGVPFPFASNSSTYPDKLSAYECGFDPSGDARSRFDIRFYLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASDRE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.755 kDa

MLEFAPICISLVISLLLSLILLVVPFLFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSFNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

ND3

NADH-ubiquinone oxidoreductase chain 3

118 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.032 kDa

MLFFAVLGLLFFLIFFLVLVFHAFLWNLDLGIFSGERSWVSSFECGFLSQRVTENYFSYTYFILLVFFVVFDLEVSLLLNMPLQGVLYKNFFSYLFFLVLLGIGFLVEVRRGYVRWAY

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.546 kDa

MILYVLPTSLSLCLLLMIIYLLTANLFKFASYELKTPFECGFDPLSNMRSPMTTRFFILTVLFLIFDVEVVLLFPVLSMVSFMTSPLIIMSIILFMMVLLIGLLYEMYYGVLDWVLN

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.607 kDa

MLMLSIMATIIFIITIVVMMLATLLSKKTLLDREKCSPFECGFDPMNSSRLPFALRFFLIAIIFLIFDVEIALLLPMVMIIKTSNLMNWTMTSFFFIFILLIGLYHEWNQGALEWNN

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

14.036 kDa

MKFIFMYFIFIILISSILLLLNKFISIYKKKDYEKSSPFECGFNPITKANLPFSLPFFLMTMMFLIFDVEIILFLPIIFYLKSSSTMISYLMISIFLILLITTLILEWMNNYLNWLF

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.535 kDa

MVTILIYLLILLIINVVLLLLGLIINKRSYSDREKNSPFECGFDPSIHTRAPFSMRFFLLAVIFLIFDVEIILLLPLTSNILNSNTHWPLTSSMIFLTILLIGLFHEWNQGSLDWMK

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.982 kDa

MILTALSSAIALLVPIIILGAAWVLASRSTEDREKSSPFECGFDPKSTARIPFSTRFFLLAIIFIVFDIEIVLLMPLPTILHTSDVFTTVTTSVLFLMILLIGLIHEWKEGSLDWSS

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.465 kDa

MEFKGILILLIISGTLSILILGASYILGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWEN

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.668 kDa

MIEYLAVLIYFLFSLALASLIIFLSFIFAPQKPDPEKISAYECGFDPFDDARGKFDIRFYLVAILFIIFDLEVTFLFPWAVTLGKIGFFGFWTMMAFLIILTIGFIYEWKKGALEWE

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.051 kDa

MMTTTIFLFSITSAVAIIFALAAHILPTRNNDGEKNSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPAASFLTHPTTLILISLAFMAILDAGLVFEWINPPLEWAE

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.268 kDa

MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE

ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.268 kDa

MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE

ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.088 kDa

MYNIIIIVLSILAVTAALVFAAHFLPSRKLDLENGSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPFPQALFIFNSSHVLYIATLFLAILLIGLIFEWTQGGLDWAE

ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.734 kDa

MTTIIFLFSITIAVAVVLGLAAHALPNRTSDSEKSSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPAASLITPPSTLIPISMVFMVILTLGLVFEWINGGLEWAE

ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.34 kDa

MIYTNNIFNFLTLFVSILIFLITTLITFAAHFLPSRNTDSEKSSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPLPFSVFFHPIHTPLILTVGLIFEWVQGGLDWAE

ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.101 kDa

MVMGLSVVFVCIVCCLFTGLFMMLSEKRGLDREKCSPYECGFEPIGSARSPFSIRFFLVAVLFVVFDVEVVLLMPFAYMFFYGKSVLGILSSSGFLLILFVGLYHEYREGSLEWVG

ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.202 kDa

MMMLMTSITISFLLPMIVMLLATTLSKKSINDREKSSPFECGFDPKLNMPFSIQFFLIAVIFLIFDVEIALILPIVIIMKTSNIMVWTLSTMLFIIILLVGLYYEWNQGALKWAN

ND3

NADH-ubiquinone oxidoreductase chain 3

114 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.715 kDa

MTYLVYIVFTIVLTVGLILVSYLLSQAQPDSEKVSAYECGFSPLGDARQKFDVSFYLIAILFIIFDLEVVFILPFASVIHNVSLLGGWITIIFLVILTIGFIYEFVSGAITDSF

ND3

NADH-ubiquinone oxidoreductase chain 3

114 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.431 kDa

MIFYLHITIFLVVCLLMMLFFSLGFQGKKAKEKNSPFECGFDPFSLSRVPFSLKFFFVGIVFLIFDVEIVVILPFPLVMMTKNLMFVFSFTFINFLIVLGLLYEFKYSMLDRLK

ND3

NADH-ubiquinone oxidoreductase chain 3

111 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.99 kDa

MILIWLSIFMLVFIMLTLGMFVNKKVSLDREKSSPFECGFDPLNSSRTPFSIRFFVITLIFLIFDVEIYLLLPMVYLNMSSPTTYLIIFFTFILVAGVFYEWSEGALSWIK

ND3

NADH-ubiquinone oxidoreductase chain 3

111 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.102 kDa

MLVLVMVVLFTLVLLFVFYIGNFVLSCKDFYKNKISSFECGFVSIGKIQNSFSIHFFIMMLMFVIFDLEVVMFLGILVSDLNSLISFFMLLMFIFGGFYMEWWYGKLVWLI

ND3

NADH-ubiquinone oxidoreductase chain 3

70 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

8.443 kDa

multiple

FYYINPREFVNKKVCLDREKSSPFECGFDPLEFLSYPLFIRFFVITLIFLIFDVEIYLLLPMVYLNMSSP