NAXD

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

389 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

41.484 kDa

MVTRAGAGAAVAATAVVALLSAALALYRPPLDAVLERAFSLRKVHSIKDMENTLQLVRNIIPPLSSTKHKGQDGRIGVVGGCQEYTGAPYFAAISALKVGADLSHVFCASAAAPVIKAYSPELIVHPVLDSPSAVDEVEKWLPRLHALVFHCERGTQPGFLFWQGILEASKARDIPVVIDADGLWLVAQQPALIQGYQKAVLTPNHMEFSRLYDAVLRGPVDSDDRHGSVLRLSQALGNVTVVQKGERDILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPEKTNGGMLDLKLTIWGPKIETGIKTRAQGGCGPRTTAPTSPHLPLSPSPQVQPSPGGCIRRLLSHQAVQPPSLPEARSLHHHLRHDRRGGGRLPQAL

NAXD

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

347 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

36.941 kDa

MAARAGPRAALAGAAAVALLSAALVLYELPPGAVLQRAFSLHKAHSVEDMENTLQLVRNIIPPLTTKKHKGQDGRIGVVGGCQEYTGAPYFAAISAHKVGADLSHVFCTREAAPVIKSYSPELIVHPVLDSPSAVHDVEEWLPRLHALVVGPGLGRDNILLENVKGILEASKARDIPVIIDADGLWLIAQHPALIQSYQKAVLTPNHVEFNRLSEAVLSHQVDGSDHHEAVRRLSQALGNVTVVQKGERDVISDGKQVLECTQEGSSRRCGGQGDLLSGTLGVLVHWALHAAPEKTNGSSPLLLAALGACSLTRQCSLQAFQKHGRSTTTTDMIAEIGPAFSKLFET

NAXD

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

347 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

36.576 kDa

MVTRAGAGTAVAGAVVVALLSAALALYGPPLDAVLERAFSLRKAHSIKDMENTLQLVRNIIPPLSSTKHKGQDGRIGVVGGCQEYTGAPYFAAISALKVGADLSHVFCASAAAPVIKAYSPELIVHPVLDSPNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKAVLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQALGNVTVVQKGERDILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGSSPLLVAAFGACSLTRQCNHQAFQKHGRSTTTSDMIAEVGAAFSKLFET

Naxd

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

343 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

36.518 kDa

MAVCPYGAAAVVMALLSAAIAFHCSPLLAVLQRALSLHTAHATKDMDNLFQLVRNIVPALTSKKHKGQDGRIGIVGGCQEYTGAPYFAGISALKVGADLTHVFCAREAAPVIKSYSPELIVHPVLDSSDAVEEVEKWLPRLHALVVGPGLGRDDLLLNNVRGILESTKARDIPVVIDADGLWLIAQRPALVHGYQKAVLTPNHVEFSRLWDAVLSSPMDTSNHSGSVLKLSQALGNITIVQKGEQDLISNGQQVLVCNQEGSSRRCGGQGDLLSGSLGVMAHWALRAGPEKTNGSSPLLVAAWGACTLTRECNHLAFQKYGRSTTTTDMIAEVGAAFSKLFTT

Naxd

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

343 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

36.717 kDa

MAVHACGAAAAVVALLSAAIALQWSPLYAVLQRALSLHTAHATKDMENLFQLVRNIVPALTSKKHKGQDGRIGIVGGCQEYTGAPYFAGISALKVGADLTHVFCAREAAPVIKSYSPELIVHPVLDSSNAVEEVEKWLPRLHALVVGPGLGRDDLLLNNVRGILESTKARDIPVVIDADGLWLVAQQPALIHSYHKAILTPNHVEFSRLWEAVLSSPMDSNDLKGSTLKLSQALGNITVVQKGEQDLISNGQQVLVCNQEGSSRRCGGQGDLLSGSLGVMVHWALRAGPEKTNGSSPLLVAAWGACTLTRECNRQAFQKYGRSTTTTDMITEVGTAFSRLFTT

naxd

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

330 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

35.873 kDa

MNLLKRATFIFSEQPLSLAIVIERSFSLGSSGMDNVIPLVRNTIPPLTSKKHKGQDGRIGIIGGCQEYTGAPFFAAISALKVGADLSHVFCTKDAAPVIKSYSPELIVHPVLDSPNAVEEIEKWLPRLHSVVVGPGLGREDMLLKNAKEIIERSKLRGIPVIIDADGLWLVAKEPSVIQGYQRGILTPNFMEFTRLYEAMHHEPLDSSDHKRSAQQLSIALGHLTLVLKGEEDIITDGKNILTCSQEGSGRRCGGQGDLLSGSLGAFAHWAFSSPSDATKGMNPSLVAAFGATSLTRQCNRQAFHKHGRSTTTSDMIQEINSAFKKLFES

NAXD

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

329 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

35.099 kDa

MALGPRYGAIRACGRVLERAFSLRKAHSIKDMENTLQLVRNIIPPLSSTKHKGQDGRIGVVGGCQEYTGAPYFAAISALKVGADLSHVFCASAAAPVIKAYSPELIVHPVLDSRSAVHEAEKWLPRLHALVVGPGLGRDDALLRNVQGILEASKARDIPVVIDADGLWLVAQQPALIQGYRKAVLTPNHMEFSRLYDAVLRGPMDSNDSHGSVLRLSQALGNVTVVQKGERDILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPEKTNGSSPLLVAAFGACSLTRQCNHQAFQKHGRSTTTSDMIAEVGAAFSKLFET

NAXD

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

329 amino acids

Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.

Belongs to the NnrD/CARKD family.

34.809 kDa

MALGPGCRAVRGCRPVLKRAFSLHKAHSVKDMESILQLVRSVVPALTTKKHKGQDGRIGVVGGCREYTGAPYFAAISALKVGADLSHVFCTQEAAPVIKAYSPELIVHPVLDSPEAVRDVEQWLPRLHALVVGPGLGRDDALLENVKGILEASKARGIPVVIDADGLWLIAQQPALIQGYRKAVLTPNHVEFGRLSEAVLGVPLDGGDRHGAVLRLSQALGNVTVVQKGEQDVISDGEQVLECSQEGSGRRCGGQGDLLSGSLGVLAHWALRAGPQKTGGPSPLLVAAFGACALTRQCSQQAFQKYGRATTTSDMVAEVGPAFRRLFEA