Protein
NAC domain-containing protein 96
Organism
Arabidopsis thaliana
Function
Transcriptional activator involved in the positive regulation of abscisic acid (ABA) responsive genes. Acts as a positive factor of ABA-mediated responses. Involved in the transcriptional activation of ABA-inducible genes in response to dehydration and osmotic stresses. Plays a positive role in both stomatal closure and water loss under dehydration stress conditions. Acts synergistically with ABF2 to activate the dehydration stress-response factor RD29A transcription. Binds to the consensus core cis-acting elements 5'-CGTA-3' and 5'-CACG-3' at the RD29A promoter (PubMed:24285786). Involved in hypocotyl graft union formation. Required for the auxin-mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:25182467).
Sequence
MGSSCLPPGFRFHPTDEELIEYYLKRKVEGLEIELEVIPVIDLYSFDPWELPDKSFLPNRDMEWYFFCSRDKKYPNGFRTNRGTKAGYWKATGKDRKITSRSSSIIGYRKTLVFYKGRAPLGDRSNWIMHEYRLCDDDTSQGSQNLKGAFVLCRVAMKNEIKTNTKIRKIPSEQTIGSGESSGLSSRVTSPSRDETMPFHSFANPVSTETDSSNIWISPEFILDSSKDYPQIQDVASQCFQQDFDFPIIGNQNMEFPASTSLDQNMDEFMQNGYWTNYGYDQTGLFGYSDFS