Mup41

Probable tail assembly protein FS-gp41

188 amino acids

Required for tail assembly (Probable). Together with gp41, may act as a chaperone promoting the assembly of the tape measure protein (TMP) and the tail tube protein (TTP) into a functional tail shaft (Potential).

Belongs to the mulikevirus tail assembly protein family.

20.727 kDa

MDEMNLGPEAQELHDSIVAEIQSGVLKLKDGLPFGTGDETEMQYDVTLRELTAGDMIDAQAAAEKLVMSKEGPVLVSSPSRMGLEMLRRQIASVGCIKGPLSMALIRKLSVDDFQRLSLATEMYDMAVAASLTQERGGEWLRCRNDIEKAATAIGVILKSGPEWALSLPLSRFFRHCQQAKTLSQYHR

Mup41

Probable tail assembly protein gp41

144 amino acids

Required for tail assembly (Probable). Together with FS-gp41, may act as a chaperone mediating the interaction between the tape measure protein (TMP) and the tail tube protein (TTP) thereby directing the polymerization of TTP to form a tail of the correct length (Potential).

Belongs to the mulikevirus tail assembly protein family.

15.584 kDa

MDEMNLGPEAQELHDSIVAEIQSGVLKLKDGLPFGTGDETEMQYDVTLRELTAGDMIDAQAAAEKLVMSKEGPVLVSSPSRMGLEMLRRQIASVGCIKGPLSMALIRKLSVDDFQRLSLATEMYDMAVAASLTQERGRVAAVPE