Mtnd1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.059 kDa

MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNLGILFILATSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSYSLQTLITTQEHMWLLLPAWPMAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTTIIFLGPLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISLPIFTAGVPPYM

Mtnd1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.145 kDa

MYFINILTLLIPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWIPLPMPHPLINLNLGMLFILATSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMSGSFSLQMLITTQEHIWLLIPAWPMAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTSIVFLGPLYHINYPELYSTSFMTETLLLSTTFLWIRASYPRFRYDQLMHLLWKNFLPLTLAFCMWYISLPIFLAGIPPYT

mtnD1

Acireductone dioxygenase 1

189 amino acids

Catalyzes 2 different reactions between oxygene and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway.

Belongs to the acireductone dioxygenase (ARD) family.

21.19 kDa

MTLVQVMAQDDRDQVVLRTADRTEIADTLRPFGIQLDRWPLRELPADAGQDAVLAAYRAEVDEVCRAGGYRFVDVVRLVPAPEDPEWPARAAAARGRFLDEHRHTEHEVRFFVEGRGCFYLHLGDKVYALVCEAGDLVSVPAGTTHWFDMGAQPHFCAIRFFEREDGWIGDFTGSPIASTMPTLDELVG

mtnD1

Acireductone dioxygenase

188 amino acids

Catalyzes 2 different reactions between oxygene and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway.

Belongs to the acireductone dioxygenase (ARD) family.

21.306 kDa

MSRLRIFADTNPATPEFDSRDGDAIASELKKIGVTFERWHASAPVEPGATPEQVMDAYRADIDRISAERGFKTVDVVSIAPDNPKREEMRAKFLDEHFHKEDEVRFFVAGSGLFTLHVDAKVYEIECVKDDLIAVPDSTLHWFDMGPEPHFVAIRFFTEPDGWVGHFTGTEIAKQFPRYAPEKPHKAS

mtnD1

Acireductone dioxygenase 1

173 amino acids

Catalyzes 2 different reactions between oxygene and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway.

Belongs to the acireductone dioxygenase (ARD) family.

19.63 kDa

MTTLSIYHRPHITQPIQQLTAFNDIASLLASAGIQLEHWQAEAPPLNASSETILTQYHADIERLKQQEGYTSADVISLTPNHAERKALREKFLQEHTHSEDEVRFFVRGSGAFFVPIGEQVFQLTCEAGDLLRVPANTPHWFDCGEFPDFVAIRIFTNPEGWVGHFTGRETFH