MFAP5

Microfibrillar-associated protein 5

173 amino acids

May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils (PubMed:8557636).

Belongs to the MFAP family.

19.612 kDa

MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

MFAP5

Microfibrillar-associated protein 5

173 amino acids

May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils (PubMed:8557636).

Belongs to the MFAP family.

19.612 kDa

MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

MFAP5

Microfibrillar-associated protein 5

170 amino acids

May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils (By similarity).

Belongs to the MFAP family.

19.08 kDa

MTFFGPKVLLLLTALIMSSGRTPLGVSGQRGDDVTTVTSETFTEDPNLVNDPATDETVLADIQPSTDDLASLNDKNTTTECRDEKFACTRLYSVHRPIKQCLHQICFTSSRRMYVINNEICSRLVCKEHEAMKDELCRQKAGLPPRRLRRSNYFRLPPCDNVNLQGPSGL

MFAP5

Microfibrillar-associated protein 5

170 amino acids

May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils (By similarity).

Belongs to the MFAP family.

19.08 kDa

MTFFGPKVLLLLTALIMSSGRTPLGVSGQRGDDVTTVTSETFTEDPNLVNDPATDETVLADIQPSTDDLASLNDKNTTTECRDEKFACTRLYSVHRPIKQCLHQICFTSSRRMYVINNEICSRLVCKEHEAMKDELCRQKAGLPPRRLRRSNYFRLPPCDNVNLQGPSGL

Mfap5

Microfibrillar-associated protein 5

164 amino acids

May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (PubMed:23963447). Component of the elastin-associated microfibrils (By similarity).

Belongs to the MFAP family.

18.538 kDa

MLFLGQKALLLVLAISIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTALADITPSTDDLAGDKNATAECRDEKFACTRLYSVHRPVRQCVHQSCFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGL