MYD88

Myeloid differentiation primary response protein MyD88

299 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response.

33.781 kDa

MATVPVGAGSAPGPEPADLHSVPMVALNYGVRRRLGLYLNPRAATAADWTALAEKLGHDYLEIRRLEALPDPTAALLEEWQSRCPGGATVGQLLELLRQLGRHDVLLELGGSVEEDCKKYLRRKQQEAEQPLQVPAVDSSVPKTSELMGITTRDDPYGHGTEMFDAFICYCQKDLQFVQEMIRELEQTEFKLKLCVFDRDVLPGTCVWSISGELIERRCRRMVVVISDDYLESDECDFQTKFALSLSPGARLKRLIPVKCKTMKNEFPSILRFITICDYTNPCTKKWFWTRLAKSLLLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (PubMed:17936907, PubMed:18760477). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.709 kDa

MAEGVPRAGSALPAASLSSLPLAALNVRVRRRLSLFLNVRAPVAADWTVLAEAMDFEYLEIQQLEKYADPTSRLLDDWQRRPGASVGRLLELLAKLGRDDVLMELGPSIEEDCQKYILKQQQEASEKPLQVDSIDSSITRINDMAGITIRDDPLGQKPECFDAFICYCPSDIEFVHEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDEYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKPMKKEFPSILRFITVCDYTNPCTQNWFWTRLAKALSMP

Myd88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.354 kDa

MAAGGPGTEPAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.242 kDa

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed:15361868, PubMed:18292575). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:15361868, PubMed:24316379, PubMed:19506249). Increases IL-8 transcription (PubMed:9013863). Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes. MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.233 kDa

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.354 kDa

MAAGGPGTEPAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.354 kDa

MAAGGPGTEPAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Myd88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed:9697844). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:9575168, PubMed:9697844). Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway (PubMed:9697844). Isoform 2 is defective in its ability to induce IRAK phosphorylation and NF-kappa-B activation and can function as a negative regulator of activation by IL-1 or lipopolysaccharide (LPS) (PubMed:11909531). Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (PubMed:17018642). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (PubMed:17635956, PubMed:21998396). Mediates leukocyte recruitment at the inflammatory site (PubMed:18941239).

33.753 kDa

MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLEIRELETRPDPTRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQNQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.256 kDa

MAAGGPGAGSAAPISSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.27 kDa

MAAGGPAAGSAAPISSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.242 kDa

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Myd88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.856 kDa

MSAGGPRVGSVSVDSYLFSLPLVALNVGVRRRLSLFLNPRTTAAADWTSLAEEMGFEYLEIREFETRPDPTRSLLDAWQGRSGSSVGRLLELLALLDREDILYELKDRIEEDCQKYIRNQQKQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPSDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP

MYD88

Myeloid differentiation primary response protein MyD88

296 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.78 kDa

MTEGVPSAGSALPTPAMSSLPLAALNVRVRRRLSLFLNVRAPVAADWTVLAEAMDFEYLEIQQLEKYADPTSRLLDDWQRRPGASVGRLLELLAKLGREDVLMELGPSIEEDCQKYILKQQQEASEKPLQVDSIDSSIPRINDMAGITIRDDPLGQKPEYFDAFICYCPSDIEFVHEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDXYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKPMKKEFPSILRFITVCDYTNPCTQNWFWTRLAKALSMP

MYD88

Myeloid differentiation primary response protein MyD88

293 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

33.254 kDa

MAAGGSGAESAPPTPSMSSLPLAALNVRVRHRLSLFLNVRTQVAADWTGLAEEMNFEYLEIRRLETHPDPTRSLLDDWQGRPGASVGRLLELLAKLGRDDVLVELGPSIEEDCRKYILKQQQEAAEKPLQVDSVDSSIPWMSGITIRDDPLGQMPEHFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPVKYKSMKKEFPSILRFITVCDYTNPCTKSWFWTRLARALSLP

myd88

Myeloid differentiation primary response protein MyD88

288 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response.

33.244 kDa

MAYCNSKTDLSRVPLLALNMGFRKKVGLYLNPRNAVAADWMALAEALGFTFLEIKNYESAINPTVKVLEDWQARSTDATVGKLLSILSEVERNDVLEDLQPMIDEDVRRYCERLNRDPEPPVQVNQVDSCFHRTLERVGLTLHDDPEGTPELFDAFICYCQRDFEFVQEMIRQLEETDFKLKLCVFDRDVLPGSCVWTITSELIEKRCKRMVVVISDEYLDSEACDFQTKFALSLSPGARNKRLIPVKYKSMSKPFPSILRFLTLCDYTRPCTQAWFWKRLAKALSLP

myd88

Myeloid differentiation primary response protein MyD88

284 amino acids

Adapter protein involved in the Toll-like receptor and Il-1 receptor signaling pathway in the innate immune response.

32.874 kDa

MASKLSIDHEAIPVTALNCSFRKKLGLFLNPTNTVAADWRTVAELMDFTYLEIKNFEKRDCPFEKVLTDWETRPDATVANLLSILEKAERKDVISELKEILDDDCRKYMERQQRKPLQVPVVDSCGPRTQEREGITLYDDPQGLTPETFDAFICYCQSDIQFVHEMIKQLEHTEYNLKLCVFDRDVLPGTCVWTIASELIEKRCKRMVVVISDDYLDSDACDFQTKFALSLCPGARTKRLIPVVYKSMKRPFPSILRFLTICDYSKPCTQVWFWTRLAKALSLP

myd88

Myeloid differentiation primary response protein MyD88

283 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response.

32.867 kDa

MSTSLDLWNIPLRALNINVRKRLGLFLNPRNTVASDWMSVAENMGFSYLEIKNYEDCLDPTRRILEDWQARCPGAKVGKLLSILDNVDRKDVVEDLRDLIEEDCRRYIERQNEPPLQVPEVDSCVPKTQERQGITLEDDPEGGIPELFDAFICYCQSDFDFVHEMXQQLEQTDHKLKLCVFDRDVLPGSCVWTITSELIEKRCKRMVVVISDEYLDSDACDFQTKFALSLCPGARSKRLIPVKYRSMKKPFPSILRFLTVCDYTRPCTQSWFWVRLARALSLP

myd88

Myeloid differentiation primary response protein MyD88

283 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response.

32.505 kDa

MACGSSLGSVDMNSIPLVALNYNVRHRLSLYLNPNAVVAAGWTQLAEEMGYDYLEIKNFERFPDCTMKLLEDWEKKCFRATVGGLLEMLKKMERNDILTDLGPLIEADCMKHLEKKNAPLPLQDDKVDSSEQYRITKSDDPSGSLPETFDAFICYCAQDISFVQEMISRLEQTDYKLKLCVFDRDVLPGTCLWSITSELIEHRCRKMVVIISDDYLDSSECDFQTKFALSLGPGAREKRLIPVKYKPMKRPFPSILRFITLCDYTNPCTKGWFWERLAKALSR

myd88

Myeloid differentiation primary response protein MyD88

282 amino acids

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response.

32.552 kDa

MSASLDLWNIPLRALNINVRKRLGLFLNPRNTVASDWMSVAENMGFSYLEIKNYEDCQDPTRKIYRTGKPLSRAQVGKLVSILDNVTRKDVVEDLRVLIEEDCKRYIERQNEPPVQVPEVDSCVPRTPERQGITLEDDPEGGIPELFDAFICYCQSDFDFVHEMIQQLEQTDHKLKLCVFDRDALPGSCVWTITSELIEKRCKRMVVVISDEYLDSDACDFQTKFALSLCPGARSKRLIPVKYKSMKKPFPSILRFLTVCDYPRPCTQSWFWVRLAKALSLP