Function
Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725).
Sequence
MGRPPCCEKIGVKKGPWTPEEDIILVSYIQEHGPGNWRSVPTHTGLRRCSKSCRLRWTNYLRPGIKRGNFTEHEEKTIVHLQALLGNRWAAIASYLPERTDNDIKNYWNTHLKKKLKKINESGEEDNDGVSSSNTSSQKNHQSTNKGQWERRLQTDINMAKQALCEALSLDKPSSTLSSSSSLPTPVITQQNIRNFSSALLDRCYDPSSSSSSTTTTTTSNTTNPYPSGVYASSAENIARLLQDFMKDTPKALTLSSSSPVSETGPLTAAVSEEGGEGFEQSFFSFNSMDETQNLTQETSFFHDQVIKPEITMDQDHGLISQGSLSLFEKWLFDEQSHEMVGMALAGQEGMF