Function
Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322).
Sequence
MGRAPCCDKANVKKGPWSPEEDVKLKDYIDKYGTGGNWIALPQKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDRIILSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTKLKKKLLGRQKQMNRQDSITDSTENNLSNNNNNKSPQNLSNSALERLQLHMQLQNLQSPFSSFYNNPILWPKLHPLLQSTTTNQNPKLASQESFHPLGVNVDHQHNNTKLAQINNGASSLYSENVEQSQNPAHEFQPNFGFSQDLRLDNHNMDFMNRGVSKELFQVGNEFELTNGSSWWSEEVELERKTTSSSSWGSASVLDQTTEGMVMLQDYAQMSYHSV