Function
Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning (PubMed:19542355, PubMed:21533201). Functions in both lateral organ separation and axillary meristem formation, in part through genetic interaction with the NAC domain genes CUC2 and CUC3 and the homeobox gene STM (PubMed:19542355). May be recruited by a variety of developmental programs for the development of floral organs and the initiation of ovule outgrowth (PubMed:21533201).
Sequence
MFITEKQVWMDEIVARRASSSWDFPFNDINIHQHHHRHCNTSHEFEILKSPLGDVAVHEEESNNNNPNFSNSESGKKETTDSGQSWSSSSSKPSVLGRGHWRPAEDVKLKELVSIYGPQNWNLIAEKLQGRSGKSCRLRWFNQLDPRINRRAFTEEEEERLMQAHRLYGNKWAMIARLFPGRTDNSVKNHWHVVMARKYREHSSAYRRRKLMSNNPLKPHLTNNHHPNPNPNYHSFISTNHYFAQPFPEFNLTHHLVNNAPITSDHNQLVLPFHCFQGYENNEPPMVVSMFGNQMMVGDNVGATSDALCNIPHIDPSNQEKPEPNDAMHWIGMDAVDEEVFEKAKQQPHFFDFLGLGTA