MXRA8

Matrix remodeling-associated protein 8

463 amino acids

Transmembrane protein which can modulate activity of various signaling pathways, probably via binding to integrin ITGAV:ITGB3. Mediates heterophilic cell-cell interactions in vitro. Inhibits osteoclastogenesis downstream of TNFSF11/RANKL and CSF1, where it may function by attenuating signaling via integrin ITGB3 and MAP kinase p38. Plays a role in cartilage formation where it promotes proliferation and maturation of growth plate chondrocytes. Stimulates formation of primary cilia in chondrocytes. Enhances expression of genes involved in the hedgehog signaling pathway in chondrocytes, including the hedgehog signaling molecule IHH; may also promote signaling via the PTHLH/PTHrP pathway. Plays a role in angiogenesis where it suppresses migration of endothelial cells and also promotes their apoptosis. Inhibits VEGF-induced activation of AKT and p38 MAP kinase in endothelial cells. Also inhibits VTN (vitronectin)-mediated integrin ITGAV:ITGB3 signaling and activation of PTK2/FAK. May play a role in the maturation and maintenance of the blood-brain barrier.

52.034 kDa

MELRAWVLLWRLVLLQSSAVLLSSGPSGPATSDRSVVSESTVSWAAGARAVLRCQSPRMVWTQDRLHDRQRVVHWDLSGSKAGGPARRLVDMYSTGEQRVGEQRLGEQRVGEQRVYEPRDRGRLLLPPSAFHDGNFSLFIRAVEETDEGLYTCNLHHHYCHLYESLAVSLEVTDDPRAAGAHWDGEKEVLAVERGAPALLTCVNRAHVWTDRHLEEAQQVVHWDRQPPGVPHDRADRLLDLYASGERRAYGPPFLRDRVAVEADAFARGDFSLLIDPVEPADEGTYSCHLHHHYCGLHERRVFHLRVTEPAARPPPPPRDSPGNGSSHSGAPGPGARDPTLTRGRSVINVIVPEGRAHFFQQLGYVLATLLLFILLLITVVLATRQRRRGGYEYSNKKSKSKGKDINMAEFAVASGDQSLYRSEDIRLDYKNNILKERAEVAHSLPPAKNIDLDKEFRKEYCK

MXRA8

Matrix remodeling-associated protein 8

442 amino acids

(Microbial infection) Contributes to arthritogenic alphavirus pathogenesis and acts as a receptor for these viruses.

49.132 kDa

MALPSRILLWKLVLLQSSAVLLHSGSSVPAAAGSSVVSESAVSWEAGARAVLRCQSPRMVWTQDRLHDRQRVLHWDLRGPGGGPARRLLDLYSAGEQRVYEARDRGRLELSASAFDDGNFSLLIRAVEETDAGLYTCNLHHHYCHLYESLAVRLEVTDGPPATPAYWDGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQPPGVPHDRADRLLDLYASGERRAYGPLFLRDRVAVGADAFERGDFSLRIEPLEVADEGTYSCHLHHHYCGLHERRVFHLTVAEPHAEPPPRGSPGNGSSHSGAPGPDPTLARGHNVINVIVPESRAHFFQQLGYVLATLLLFILLLVTVLLAARRRRGGYEYSDQKSGKSKGKDVNLAEFAVAAGDQMLYRSEDIQLDYKNNILKERAELAHSPLPAKYIDLDKGFRKENCK

Mxra8

Matrix remodeling-associated protein 8

442 amino acids

Transmembrane protein which can modulate activity of various signaling pathways, probably via binding to integrin ITGAV:ITGB3 (PubMed:18366072, PubMed:22492581, PubMed:29702220). Mediates heterophilic cell-cell interactions in vitro (PubMed:18366072). Inhibits osteoclastogenesis downstream of TNFSF11/RANKL and CSF1, where it may function by attenuating signaling via integrin ITGB3 and MAP kinase p38 (PubMed:22492581). Plays a role in cartilage formation where it promotes proliferation and maturation of growth plate chondrocytes (PubMed:29702220). Stimulates formation of primary cilia in chondrocytes (PubMed:29702220). Enhances expression of genes involved in the hedgehog signaling pathway in chondrocytes, including the hedgehog signaling molecule IHH; may also promote signaling via the PTHLH/PTHrP pathway (PubMed:29702220). Plays a role in angiogenesis where it suppresses migration of endothelial cells and also promotes their apoptosis (By similarity). Inhibits VEGF-induced activation of AKT and p38 MAP kinase in endothelial cells (By similarity). Also inhibits VTN (vitronectin)-mediated integrin ITGAV:ITGB3 signaling and activation of PTK2/FAK (By similarity). May play a role in the maturation and maintenance of the blood-brain barrier (PubMed:14603461).

49.75 kDa

MELLSRVLLWKLLLLQSSAVLSSGPSGTAAASSSLVSESVVSLAAGTQAVLRCQSPRMVWTQDRLHDRQRVVHWDLSGGPGSQRRRLVDMYSAGEQRVYEPRDRDRLLLSPSAFHDGNFSLLIRAVDRGDEGVYTCNLHHHYCHLDESLAVRLEVTEDPLLSRAYWDGEKEVLVVAHGAPALMTCINRAHVWTDRHLEEAQQVVHWDRQLPGVSHDRADRLLDLYASGERRAYGPPFLRDRVSVNTNAFARGDFSLRIDELERADEGIYSCHLHHHYCGLHERRVFHLQVTEPAFEPPARASPGNGSGHSSAPSPDPTLTRGHSIINVIVPEDHTHFFQQLGYVLATLLLFILLLITVVLATRYRHSGGCKTSDKKAGKSKGKDVNMVEFAVATRDQAPYRTEDIQLDYKNNILKERAELAHSPLPAKDVDLDKEFRKEYCK

MXRA8

Matrix remodeling-associated protein 8

437 amino acids

Transmembrane protein which can modulate activity of various signaling pathways, probably via binding to integrin ITGAV:ITGB3. Mediates heterophilic cell-cell interactions in vitro.

50.704 kDa

MEQLAKLLLWQLLLQQSSVVYLYSVPADASNPDSVVVSVLNISATRGSQAVLPCKSYRMVWTQDRLNDRQRVVHWDVYSTYYGDNKMERLCDMYSAGNQRVYSSYNQGRILMPQNAFTDGNFSLVIKDVAESDAGVYSCNLHHHYCHLYETVKIQLDITKKAKAAKEYWDGEKAVIVALEGSTVMLPCVNRNHIWTERHSEEEQQVVHWDRQPPGVPHDRADRLIDLYASGERRSYGPLFIRQKMNITDTAFALGDFSLRISELENADEGTYSCHLHHHYCGLHERRIYQVFVTEPVREKKVVNLTTHNTAPAIDPNVVRGHNVINVIIPESRIHFFQQLGYVLATLLLFVVLLIIVVFITRKRRQRGYEYNVKKYGEKDVNLKEFTVDTTDLTQYKSEDIRLDYKNNILKEKAEQARSFPAKNIDLDKDFRKEYCK

mxra8

Matrix remodeling-associated protein 8

435 amino acids

Transmembrane protein which can modulate activity of various signaling pathways, probably via binding to integrin ITGAV:ITGB3. Mediates heterophilic cell-cell interactions in vitro.

50.88 kDa

MEIRCKVLVCHIILLHSATVYLYSVPASQQNPESVVVSVTNISTHVGDQGFLTCESYRMVWTQDNLMDRQRVVHWDLYNSQGVYRGERLLDMFSAGEQRIYKDYNQRRISVSESAFQDGNFSLVIKDVSMIDQGLYSCNLHHHYCHLDETVRVQLNITKSERKVKIYWDGEKIVIVALVHSTVLLPCENHDHMWTDRHREEDQQVVHWDRQAPGIPHDRADRLIDMYASGERRAYGSLFLRRKMNVSNSAFSQGDFTLFIPYLTRGDEGTYSCHLHHHYCGLHERRIFYLSVSDRPKTEEPSKTNSDSAPAIDSNVVQENKVINVTIQESRLHFFQQLGYILATLLLFILLLTAVILITRKHQKRGYAYNLNKPQGKEVNMQEICLRPPDLIQYKKEELRIDYKNNILKERAEMDRVFAPKNIDLDLELRKEYCK

Mxra8

Matrix remodeling-associated protein 8

382 amino acids

Transmembrane protein which can modulate activity of various signaling pathways, probably via binding to integrin ITGAV:ITGB3. Mediates heterophilic cell-cell interactions in vitro. Inhibits osteoclastogenesis downstream of TNFSF11/RANKL and CSF1, where it may function by attenuating signaling via integrin ITGB3 and MAP kinase p38. Plays a role in cartilage formation where it promotes proliferation and maturation of growth plate chondrocytes. Stimulates formation of primary cilia in chondrocytes. Enhances expression of genes involved in the hedgehog signaling pathway in chondrocytes, including the hedgehog signaling molecule IHH; may also promote signaling via the PTHLH/PTHrP pathway. Plays a role in angiogenesis where it suppresses migration of endothelial cells and also promotes their apoptosis. Inhibits VEGF-induced activation of AKT and p38 MAP kinase in endothelial cells. Also inhibits VTN (vitronectin)-mediated integrin ITGAV:ITGB3 signaling and activation of PTK2/FAK. May play a role in the maturation and maintenance of the blood-brain barrier.

42.735 kDa

MELLSRVLLWKLVLLQSSAVLSSGSPGTAAASSSVVSESAVSWAAGTQAVLRCQSPRMVWTQDRLHDRQRVVHWDLSGGPGSQGRRLVDMYSAGEQRVYQPRDRDRLLLSPSAFHDGNFSLLIRAVERGDEGVYTCNLHHHYCHLYESLAVRLEVTDDPLLSRAYWDGEKEVLVVALGAPALMTCVNREHLWTDRHLEEAQQVVHWDRQLPGVPHDRADRLLDLYASGERRAYGPPFLRDRVSVNTNAFARGDFSLRIDDLEPADEGIYSCHLHHHYCGLHERRVFHLRVTEPVFEPPARASPGNGSGHNSVPSPDPTMARGHSIINVIVPEDHTHFFQQLGYVLATLLLFILLLITVVLATRHRHSGGCKTSDRKAGKSKG