Mtnr1b

Melatonin receptor type 1B

364 amino acids

High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibits adenylate cyclase activity (By similarity).

Belongs to the G-protein coupled receptor 1 family.

40.261 kDa

MPENSSIPNCCEASGLAARPSWSGSAGARPPVTARAPWVAPMLSTVVVVTTAVDFVGNLLVILSVLRNRKLRNAGNLFVVSLALADLVIALYPYPLILVAIIRDGWVLGEAHCKASAFVMGLSVIGSVFNITAIAINRYCCICHSTTYHRVCSHWYTPIYISLVWLLTLVALVPNFFVGSLEYDPRIYSCTFIQTASTQYTAAVVAIHFLLPMAVVSFCYLRIWVLVLQARRKAKATRKLRLRPSDLRSFLTMFAVFVVFAICWAPLNCIGLAVAINPEAMALQVPEGLFVTSYFLAYFNSCLNAIVYGLLNQNFRREYKRILLAIWNTRRCIQHASKHCLTEERQGPTPPAARATVPVKEGAL

Mtnr1b

Melatonin receptor type 1B

364 amino acids

High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibits adenylate cyclase activity.

Belongs to the G-protein coupled receptor 1 family.

40.194 kDa

MPDNSSIANCCAASGLAARPSWPGSAEAEPPETPRAPWVAPMLSTVVIVTTAVDFVGNLLVILSVLRNRKLRNAGNLFVVNLALADLVVALYPYPLILVAILHDGWVLGEIHCKASAFVMGLSVIGSVFNITAIAINRYWCICHSATYHRACSQWHAPLYISLIWLLTLVALVPNFFVGSLEYDPRIYSCTFIQTASTQYTMAVVAIHFLLPIAVVSFCYLRIWILVLQARRKAKAERKLRLRPSDLRSFLTMFAVFVVFAICWAPLNCIGLAVAINPEAMALQIPEGLFVTSYFLAYFNSCLNAIVYGLLNQNFRREYKRILSALWSTGRCFHDASKCHLTEDLQGPVPPAAMATIPVQEGAL

MTNR1B

Melatonin receptor type 1B

362 amino acids

High affinity receptor for melatonin. Likely to mediate the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.

Belongs to the G-protein coupled receptor 1 family.

40.188 kDa

MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLLVILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGSLEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRLCLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQADAL

mtnr1b

Melatonin receptor type 1B

152 amino acids

High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibits adenylate cyclase activity (By similarity).

Belongs to the G-protein coupled receptor 1 family.

17.832 kDa

single

HSFVYEKLFSLWNTILYVCLIWTLTVVATVPNFFVGSLEYDPRIYSCTFVQTVSSSYTITVVVIHFILPITVVTFCYLRIWILVIQVRRKVKSEFKPRMKQSDFRNFLTMFVVFVIFAFCWAPLNFIGLAVSINPTEVAPKIPEWLFVVSYF