MTF2

Metal-response element-binding transcription factor 2

593 amino acids

Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter (By similarity).

Belongs to the Polycomblike family.

67.09 kDa

MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS

Mtf2

Metal-response element-binding transcription factor 2

593 amino acids

Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter.

Belongs to the Polycomblike family.

66.924 kDa

MRDSTGAGNSLVHKRSPLRRNQKTSASLNKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPTSDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAELPLDKESVSENPTLDLPCSIGRTEGIAHSSNTSDVDLTGASSANETTSASISRHCGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEVVKDDEGKEDYQFEELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS

MTF2

Metal-response element-binding transcription factor 2

593 amino acids

Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter (By similarity).

Belongs to the Polycomblike family.

67.09 kDa

MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS

MTF2

Mitochondrial transcription factor 2

440 amino acids

Required for the processing and/or for the stability of the CYTB and COX1 intron-containing pre-mRNAs and of the ATP6 transcript. Could be a stem-loop RNA-binding protein that plays a role in determining RNA stability.

51.192 kDa

MIRTSSILKNCNYRYIHCIHRCLLNEANLKDRKTHNVERVSNEKTFEQALEEERKVFGELFEAGARVENMRHTNASKIIDKYYNGLQDNSEGTSVKKEKIVFNHSQRAQRKLPNKDHEFLKETAGNDYVYERAEPSAISTKTISEQTRTLLEKIFDEDNSINKSNRELLNLNLRKGSGMEALRQPVAHSNVKFSEEVMQEIGNKIRYQTTLDQVLEPHIDYLREAVKSDYDLLRYLKQSLDIYKKRNKDLELKMNAESSNIFEDIRSACINKPAELPKPLAMTLPYIIVKSLRLGDFDFPADRKYTLISYVYNECKNNMDASLYLTICNVDFYNLLVQLLWENFQEIRYLRRVVTEMSVNGVIGNIETVDILDKIVKEMRSLNEDVFLEAGEQLSADEEVSSSANKIVNVGVLWNKDTNNDLLIVENYLKSLKKNLTRDR

mtf2

Fatty-acid O-methyltransferase

274 amino acids

O-methyltransferase that modifies the hydroxy group of the fatty acids. Oleate is the most effective fatty acid acceptor.

Belongs to the methyltransferase superfamily.

31.353 kDa

MALGNALVEARDRVAWRLNIKVAQQAQKLVYRYATRRLKDDDVVFLNYGYEEDPPMGIPLSESDELNRYSIQLYHSTAAQADVEGKRVLEVGCGHGGGASYLARTFRPATYTGLDLNSDGINFCRRRHNIAGLEFVQGDAQDLPFPDKNFDAVLNVESSHLYPRFDVFLTEVARVLRPGGYFLYTDARPRYDIPEWERALADAPLQMLSQRAINFEVVRGMEKNLDALESVVDRVAPALLRDWIQKYGPARRAYEELRENTTEYRMYCFVKPAE