MTERF1

Transcription termination factor 1, mitochondrial

399 amino acids

Transcription termination factor. Binds to a 28 bp region within the tRNA(Leu(uur)) gene at a position immediately adjacent to and downstream of the 16S rRNA gene; this region comprises a tridecamer sequence critical for directing accurate termination. Binds DNA along the major grove and promotes DNA bending and partial unwinding. Promotes base flipping. Transcription termination activity appears to be polarized with highest specificity for transcripts initiated on the light strand.

Belongs to the mTERF family.

45.778 kDa

MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA

MTERF1

Transcription termination factor 1, mitochondrial

398 amino acids

Transcription termination factor. Binds to a 28 bp region within the tRNA(Leu(uur)) gene at a position immediately adjacent to and downstream of the 16S rRNA gene; this region comprises a tridecamer sequence critical for directing accurate termination. Binds DNA along the major grove and promotes DNA bending and partial unwinding. Promotes base flipping. Transcription termination activity appears to be polarized with highest specificity for transcripts initiated on the light strand (By similarity).

Belongs to the mTERF family.

45.65 kDa

MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFVRKIILKTLYLIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA

Mterf1

Transcription termination factor 1, mitochondrial

374 amino acids

Transcription termination factor. Binds to a 28 bp region within the tRNA(Leu(uur)) gene at a position immediately adjacent to and downstream of the 16S rRNA gene; this region comprises a tridecamer sequence critical for directing accurate termination. Binds DNA along the major grove and promotes DNA bending and partial unwinding. Promotes base flipping. Transcription termination activity appears to be polarized with highest specificity for transcripts initiated on the light strand (By similarity).

Belongs to the mTERF family.

42.937 kDa

MASRNIWRVRRNFLFDLRGWVPQYSAEVFLKSIPFRPFSVECNSKDGENGDLLNNLLTMGVDVDMARRRQPGVFNKAVTNEQELKMFLLSKGASDKVIGSIISRYPRAITRTPESLSKRWDLWREIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSVGLTHKCLCRLLTSAPRTFSNSLNLNKQMVEFLQETGISLGHNNPTDFVRKIISKNPSILIQSTKRVKTNIEFLQSTFNLDKEDLLLLICGPGARILDLSNDCTKRNYTNIKKRLLSLGCTEEEVQKFVLSYLNMIFLSEKKFNDKIDCLLEEKISTSQILENPRVLDSSIHTLKTRIRELAHAGYDVSTSSIALLSWSQRRYEAKLKRLSG

MTERF1

Transcription termination factor MTEF1, chloroplastic

284 amino acids

Transcription termination factor required for plastid-specific rRNA accumulation and protein synthesis in plastids (PubMed:19563435). Essential for embryogenesis (PubMed:12324593, PubMed:19563435).

Belongs to the mTERF family.

32.391 kDa

MMIARCSLFPPPCFSAVRIRCFAGETSDTGILFREKLIYLQDLNVDPHKALRVNPSLRSAPISSVVSVETLLSSTGLSRPAVGRILDMFPDLLTSDPESEILPVLRFLSNEISISEQDIPKSISRCPRLLISSVDYQLRPALTFLKTLGFVGRDTITSRNTVLLVSNVERTLIPKIEYLEEGLGFTREEVAKMVVRSPALLTYSVDNNLVPKVEFFIEEMRGDVKELKRFPQYFSFSLERKIKPRHRLLKEHGILMPLSEMLKVSDGQFNHWLLELRLRSAERR