MT2B

Metallothionein-like protein 2B

80 amino acids

Metallothioneins have a high content of cysteine residues that bind various heavy metals.

Belongs to the metallothionein superfamily. Type 15 family.

7.601 kDa

MSCCGGNCGCGSSCQCGNGCGGCKYSEVEPTTTTTFLADATNKGSGAASGGSEMGAENGSCGCNTCKCGTSCGCSCCNCN

MT2B

Metallothionein-like protein 2B

77 amino acids

Metallothioneins have a high content of cysteine residues that bind various heavy metals (Probable). Functions as metal chelator of copper (Cu) and zinc (Zn). Functions cooperatively with the phytochelatin synthase PCS1 to protect plants from Cu and cadmium toxicity (PubMed:18287486). Plays a role in Cu homeostasis, specifically in the remobilization of Cu from senescing leaves. The mobilization of Cu from internal sources is important for seed development (PubMed:24635746).

Belongs to the metallothionein superfamily. Type 15 family.

7.766 kDa

MSCCGGSCGCGSACKCGNGCGGCKRYPDLENTATETLVLGVAPAMNSQYEASGETFVAENDACKCGSDCKCNPCTCK

MT2B

Metallothionein-2B

61 amino acids

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Belongs to the metallothionein superfamily. Type 1 family.

5.998 kDa

MDPNCSCAAGGSCTCAGSCKCKDCRCTSCKKSCCSCCPAGCARCAQGCICKGASDKCSCCA