MT-ND6

NADH-ubiquinone oxidoreductase chain 6

178 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.31 kDa

MMTYIVTILSTIFVVSFVGFSSKPSPIYGGVGLIVSGGVGCGIVLNYGGSFLGLMVFLIYLGGMLVVFGYTTAMAMEEYPEVWVSNNTVLLTFLLGLVGEVVLMIYLLLGEEEVKFEVVLNFNSEGDWVIYDTGDSGMFSEEAMGVAALYSYGYWLVIVSGWSLVTCIIVVMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.511 kDa

MVTYIVFVLSIIFVISFVGVSSKPSPIYGGLGLIVGGGAGCGVVLSFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNKVVLGAFILGLVVESLIVIYALKSGEVKIVFEFDGLGDWVIYDTGGSGVFSEEATGIAALYSYGVWLVIVTGWSLFVSVVIIMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.68 kDa

MMMYIVFILSIIFVISFVGVSSKPSPIYGGLGLIVGGGVGCGVILSFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNKVVLGAFVLGLVVEFLIVIYALKSGEVKIMFEFDGLGDWVVYDTGGSGVFSEEATGIAALYSYGVWLVIVTGWSLFISVVIIMEITRGS

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.078 kDa

MMLYIVFILSVIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEIWLSNKAVLGAFVTGLLMEFFMVYYVLKDKEVEVVFEFNGLGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.162 kDa

MMLYIVFILSVIFVIGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEIWLLNKAVLGAFITALLMEFFMVYYVLKDKEVEIVFEFNGLGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLFIGVVVIMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.676 kDa

MMYMVFLLSVAFVISFIGFSSKPSPIYGGLGLIVGGGVGCGIVMGLGGSFLGLMVFLVYLGGMLVVFGYTTAMATEEYPEAWGSNVVILSALFVGLLVEVAMIVWMIVDGEVGLISCGLKDMEDWVVLGGYGMDVVREDYAGGSALYTYGDWLVILAGWSLFVSIFIVIEITRGR

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.441 kDa

MMYTVFVMSVLFVVGFVGVSSKPSPVYGGLGLVASGGVGCGIVVSFGGSFLGLMVFLVYLGGMMVVFGYTTAMATDEYPEAWGSNIVVLGALVGGLLMEGAAVVYLFSGGGLELVGLDLGSLENWMVFGGEGEELIREDYVGGSSLYSYGCWFMVMSGWMLFISVFIVIEVTRGR

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.104 kDa

MMYIVFIMSVLYVVGFIGFSSKPSPVYGGMSLVVSGGLGCGIIMSSGGSFLGLVVFLVYLGGMMVVFGYTIAMATEEYPETWGSNVVVLSAFLVGLLMEVFMVVWLFSGEHELVGFYFGGLESFVTLGEGGFEYVREDYSGGASLYSCGFWFLAMAGWMLFVSIFIATEITRKRY

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.773 kDa

MMTYIVFILSVIFVIGFVGFSSKPSPIYGGLVLIVSGGVGCGIIMNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNATVMGVFLLGLLMEVMLVLYVLKSEEVGVVFKFSSVGHWAIYDIGNSGVFSEEIMGVAALYSYGAWVVVVTGWSLLVGVLVILEVTRGD

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.784 kDa

MMTYIVFILSTVFVVSFVSFSSKPSPIYGGFGLIVAGGTGCGIVLNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEPYPEAWTSNKAVLAMFITGVLAELLTACYILKEDEVEVVFKFNGAGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVVVTGWSLLIGVLVIMEVTRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I subunit 6 family.

19.078 kDa

MMLYIVFILSVIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEIWLSNKAVLGAFVTGLLMEFFMVYYVLKDKEVEVVFEFNGLGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.899 kDa

MMTYIVFILSIVFVMSFVGFATKPSPIYGGLVLIISGGIGCAIVLNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNKAVLAAFITGLLSELLTACYILKDDEVEVVLKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVVVTGWSLLIGVLVIMEVTRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.899 kDa

MMTYIVFILSIVFVMSFVGFATKPSPIYGGLVLIISGGIGCAIVLNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNKAVLAAFITGLLSELLTACYILKDDEVEVVLKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVVVTGWSLLIGVLVIMEVTRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.622 kDa

MMAYIGFILSIMFVISFVGFSSKPSPIYGGLVLIMSGGFGCGIVMSFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSSAAVLGAFVLGVLMEVVLVLYVYKNGEVEVVFNFSGVGDWAVSDNGGFGVFSEEIVGVSALYSYGVWIIIVTGWSLFVGVLVILEITRGA

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.9 kDa

MMTYFVFILSTVFVIGFVGFSSKPSPVYGGVGLIISGGVGCGIVMNFSGSFLGLMVFLIYLGGMMVVFGYTAAMAMELYPEVWISNKVVLGAFVSGLFMEMLLVLYVLKEGSVGSMFEFSSLGDWVVYDVEDSGFFSKEVVGISSLYSYGVWLVVVTGWSLFIAVVVIMEVTRGG

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.843 kDa

MMTYIVFILSTVFVVGFVGFSSKPSPVYGGVGLIVSGGVGCGIIMNFSGSFLGLMVFLIYLGGMMVVFGYTAAMATELYPEVWVSNKVVFGAFVFGLFMEMLLVLYVLKEGSVGIAFEFSNLGDWVVYGVEDSGYFSKEAVGISSLYSYGMWLVVVTGWSLFIAVVVVMEVTRGG

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.678 kDa

MMTYIVFILSTIFVISFVGFSSKPSPIYGGVGLIVSGGVGCGIVMSFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNKVVMGAFISGLIVEVVFVLCVLNSEELKGLFELNGMGDWVIYSVEDSGVFSKEVMGVAALYSYGVWLVIVTGWSLLIGVIVVLEVTRGG

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.734 kDa

MMIYIGFILSIVFVISFVGFSSKPSPIYGGLVLIVSGGVGCGIVMSFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNATVLSTFILGVLMEAMLVLYMFKNGEVEVVFEFSGMGDWVVCDGGDSGVFNEEIVGVSALYSYGVWIIIVTGWSLFVGVLVVLEVTRGA

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.121 kDa

MMTYIVFILSIIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEVWVSNKVVLGTFITGLLMEFLMVYYVLKDKEVEIVFKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.911 kDa

MMTYIVFILSIIFVISFVGFSSKPSPIYGGLVLIISGAVGCGIVLSFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNKAVLGAFVMGLLSELLLACYILKDDEVDAVFEFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLFIGVLVIMEVTRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.597 kDa

MMTYVVFILSIVFVIGLIGSPSKPSPIYGGLGLIVSGGAGCGMVLNFGGSFLGLMVFLVYLGGMLVVFGYTTAMATEQYPEVWVSNKVVLGAFLLGLMMEFLAVLYVLKEGEVELVFKFSGLGDWVVYGMSDFGVFSGEAMGVAALYSYGVWLVVVTGWSLFVGVVVIMEVTRGG

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.67 kDa

MMTYIVFILSVIFVVSFVGFSSKPSPIYGGLVLIVSGGVGCGIIMNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVSNTTVMGVFLLGLLMEVMLVLYVLKSEEVGVVFKFSGVGAWAIYDTGDSGAFSEEIMGAAALYSYGAWVVIVTGWSLLVGVLVILEVTRGD

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.172 kDa

MMYIVFIMSVLYVVGFIGFSSKPSPVYGGMSLVVSGGLGCGIIMGSGGSFLGLVVFLVYLGGMMVVFGYTIAMATEEYPETWGSNVVVLGAFLVGLLMEVFMIMWLFSGEHELVGFYFGGLEDLMVLGEGGFEYVREDYSGGASLYSYGFWFLAMAGWMLFVSIFIAIEVTRKRY

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.154 kDa

MMYIVFIMSVLYVVGFIGFSSKPSPVYGGMSLIVSGGLGCGIIMSSGGSFLGLVVFLVYLGGMMVVFGYTIAMATEEYPETWGSNVVVLSAFLVGLLMEIFMIVWLFSGEHELVGFYFGGLEDLVVLGEGSFGYVREDYSGGASLYSYGFWFLAMAGWMLFVSIFIAIEVTRKRY

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.867 kDa

MMTYIAFILSTILVVSFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNYGGSFLGLMVFLIYLGGMLVVFGYTTAMAMEEYPEVWVSNKTVLSLFVLGFMAELLFAGYCISDEKLEIVLNFNGQGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLVIGVLVVMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.891 kDa

MMTYIVFILSIIFVVSFVGFSSKPSPIYGGLVLIISGAVGCGIVLSFGGSFLGLMVFLIYLGGMLVVFGYTTAMAIEQYPEVWVSNKAVLGAFVMGLLSELLLACYILKDDEVDVVFEFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLTGVLVIMEVTRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

175 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

19.016 kDa

MTMYIAFILSTIFVIGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEMYPEVWVSNKTVFGAFVSGLMMEFCMVYYALKEEEVEIIFKFNGLGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.728 kDa

MTYVVFLLSVMFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLSFGGSFLGLMMFLIYLGGMLVVFGYTTAMATEEYPETWGSNVMILGMFVLGVLMEVGLVVYMVMSDGVEIVVDFKNMGDWVVFEGDEVGLIREDSMGVAALYSYGSWLMVVAGWSLFVSIFIVIEITRGA

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.503 kDa

MTYVLFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCAIILNCGGGYMGLMVFLIYLGGMMVVFGYTTAMAIGEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNNVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.622 kDa

MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.556 kDa

MTYTLLLLSVILVVGFVGFSSKPSPIYGGLVLVVSGVVGCAVILNCGGGYLGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVGVLVGFVMEVALVLWAKEYDGLVMVLNFDNMGSWVIYEGEGSGLIREDSIGAGALYDYGRWLVVVTGWTLLVGVYIVIEIARGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.678 kDa

MTYVLFLLSVSLVMGFVGFSSKPSPIYGGLVLIVSGVVGCTIILNYGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNSVGSWMIYEGEGPGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.58 kDa

MTYALFLLSVSLVMGFVGFSSKPSPIYGGLVLIVSGVVGCAIILNYGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKGYDGMVVVVNFNSVGSWMIYEGEGPGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.775 kDa

MTYVLFTLSVMLVMGFVGFSSKPSPIYGGLALVVSGVVGCMIILNYGGAYLGLVMFLIYLGGMMVVFGYTAAMAIEEYPETWGSGFEVLACFLVGLMMEVGLVLWVLDFDEVVVMVGFNDMGNWVVFEGEGSGLVRSDSIGAGALYDYGRWLVVVAGWTLFVGVYVVIEITRGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.562 kDa

MTYALFLLSVILVMGFVGFSSKPSPIYGGLVLIISGAVGCAVILNCGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLVMEVGLVLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYVVIEIARGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

174 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.4 kDa

MTYALFLLSVILVMGFVGFSSKPSPIYGGLVLIISGAVGCAVILNCGGGYMGLVVFLVYLGGMMVVFGYTTAMAIEEYPEAWGSGAEVLVSVLVGLVMEVGLVLWVKECDGVVVAVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYVVIEIARGN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

17.883 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWGVVGYGVGFVVVLVAGLIVGGSIGSLDFGVVTVDSVGMFSVRLDFGGVAMFYSCGVGMLLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.031 kDa

MTYFVLFLGLCFVLGGLAVASKPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDLGVVGYGVGFVMVLMVGMVVGGFVGSLDFGVVTVDSVGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.008 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWGVVGYGVGFVVVLVVGLVVGGFVGSLDFGVVTVDSVGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.34 kDa

MTYFMFFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGISFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVIGYGAGFVGVLMVGMVIGGFVECWDFGVVTVDSVGMFSVRLDFGGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLTRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.338 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASIAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGVSLITVLVVGVVVGGFVEYWDFGVITVDSVGMFSVRLDFGGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLTRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.364 kDa

MTYFVIFLGVCFMLGTLAVASNPSPYYGVVGLVLASVVGCGWLVNLGVSFVSLVLFMIYLGGMLVVFVYSVSLAADPYPEAWGSWRVMGYGLGFVLVVCMGMGLGGFVDFWKIGVTTVDSGGMSFVRLDFGGVAAFYSYGVGLFLVAGWGLLLVLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.297 kDa

MTYLVSLLLMALIVGLIAVASNPAPYFAALGLVVAAGVGCGVLVSHGGSFLSLVLFLIYLGGMLVVFAYSAALAAEPFPEAWGDRSVVGYVMIYLLGVGLMVGVFWEGWYEGSWVVIDGLKEFSVLRGDTSGVAEMYSYGGGMLVICAWVLLLTLFVVLELTRGLSRGTIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.209 kDa

MTYFVFFLSLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVALAADPFPEAWGDWRVVGYGVGFVGVLVMGLVVGGFIGCLNFGVITVDSTGMLSVRLDFSGVAMFYSRGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.212 kDa

MTYFVLFLSLCFVLGGLAVASNPSPYYGVVGLVLASVVGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVALAADPFPEAWGDWRVVGYGVSFVGVLVMGLVIGGFIGCLNFGVVTVDSVGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.334 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWFLSLGASFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWQVIGYGMGFAMVLVVGVVIGGFVESWNFGVVTVDSVGMFSVRLDFSGVAMFYSWGAGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.444 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGASFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVIGYGMGFIVVLVVGVVISGFVEYWNFGVVTVDSVGMFSVRLDFSGVAMFYSWGVGMFLAAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.197 kDa

MTYLVLLLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGASFILVVIAGMIVGGLIECWKVGVVTVDSGGMFSVRLDFSGVAMFYSYGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.095 kDa

MTYFMFLLLMALVVGLVAVASNPTPYFAALGLVVAAGVGCGVLVGHGGSFLSLVLFLIYLGGMLVVFAYSAALAAEPYPEAWGSRSVLGYVLVYLLGVGLVAGFFWGGWYEGSWVVVDGLKEFSVLRGDVSGVAVMYSSGGGMLVICAWVLLLTLLVVLELTRGLSRGALRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

17.982 kDa

MTYFVVFLGLCFVLGGLAVASNPSPYYGVVGLVLASVVGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWGVVGYGASFVVVLMVGGVIGGFVGGWDFGVVTVDSVGVFSARLDFSGVAMFYSCGVGMFLVAGWGLVLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.143 kDa

MTYFVVFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWGVVGYGMSFIVVLVVGVVVGGFVEGWDFGVVTVDSAGVFFARLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.226 kDa

MTYFVIFLGICFMLGVLAVASNPSPYYGVVGLVVASVMGCGWLVSLGVSFVSLALFLVYLGGMLVVFVYSVSLAADPYPEAWGDWRVVGYGLGFVLVVWMGVVLGGLVDFWKVGVVTVDGGGVSFARLDFSGVAVFYSCGVGLFLVAGWGLLLALFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.036 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWGVVGYGVGFVVVLVVGLVVGGFVGDLDFGVVTVDSVGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.388 kDa

MTYIVSLFLLGLVLGLVAVASNPAPYFAALGLVVAAGVGCGVLVGYGGSFLSLVLFLIYLGGMLVVFAYSAALAAEPFPESWGDRSVLGYVVVYTVGVMLVAGWFWSGWYETSWVVVDEFKEFSVLRGDTSGVALMYSYGGGMLIVCAWVLLLTLFVVLELTRGLSRGALRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.454 kDa

MVYFVSMMMIGLILGLMGVASNPSPYYAALGLVTAAGVGCGLLVSYGGSFMSLILFLIYLGGMLVVFAYTAALAAEPYPEAWGDWSVLMYVGIYLTGLVIAGKYFLVGKWGDSWAGVEELSSFEVVRGDFGGVALLYSLGGWMLVLSGWVLLVTLFVVLEVTRGLSWGTLRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.6 kDa

MVYFMFIMLVGLILGLMAVASNPSPYFAALGLVVAAGVGCGLLVGHGGSFLSLVLFLIYLGGMLVVFAYTAALAAEPYPETWGDWSVLLYVSVYLLGIFFVGKYFFKEWGGLGWVGVEEMSNLEMIRGDFGGVALLYANGGIMLVLGGWVLLLTLFVILELTRGLSYGTLRVV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.274 kDa

MTYFVMFLGFCFILGAVAVASNPSPYYGVLGLVVGSVVGCGWLLSLGVSFISLALFLVYLGGMLVVFVYSVSLAADPYPQAWGSWQVVIYGVGLVLVVLVGIVVGDFVGVWNLWVGTVDYGGLGAVRLDFSGVALFYSWGAGLFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.085 kDa

MTYFMLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVVGCGWLMSLGMSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGVSFIVVLAAGAVVGGLVGCWDSGVITVDSVGMLSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSCGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.223 kDa

MTYFMLFLGLCFVLGGLGVASNPSPYYGVVGLVLASVVGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGVSFIAVLVVGVVIGGLVECWDLGVITVDSVGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSCGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.067 kDa

MTYFMLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVVGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGVSFIVVLAAGAVVGGLAGCWDLGVITVDSVGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSCGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.557 kDa

MTYVMSLFLLGLVLGLVAVASNPSPYFGALSLVGVAAFGCGVLIWHGGSFLSLVLFLIYLGGMLVVFAYSAALAAEPYPETLGSWPVVSVYFGYFFFVFGILYTNMVLDEEVWWGVSGEMDWDAVFRGDMDGVSLMYSSGGGVLLLGAWVLLLTLLVVLELVRGLGRGALRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.214 kDa

MTYFVFFLSLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVALAADPFPEAWGDWRVVGYGVGFVGVLVVGLVVGGFIECLNFGVVTVDSVGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.09 kDa

MAYIMLTLLIGMVLGVISVASNPSPYFAALGLVLVAGVGCVVLMGHGGSFLSLVLFLIYLGGMLVVFAYCAALAAEPYPEAWGEWSVLGSVLGYLLLVVGAGSWFWGGWYEGMWVPVDELIEFSVVAADSGGVALMYSLGGGLLVVSAWVLLLTLLVVLELTRGLARGALRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.138 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVVASVAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGAGFVLVLVVGGVVGGLVEFWHPGVITVDSGGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.866 kDa

MIYFVFVVLMGLVVGLMAVASNPAPYFAALGLVFSAVVGCGFLVGYGGSFLSLVLFLIYLGGMLVVFAYSAALAAEPYPESWGSWSVFLYILVYLFGFLLVGYYCYGWWYDFYWMSLDVFGEMSVLSGDVSGVPMVYSSGGFLLLVTGWVLLLALFVVLEITRGLSRGALRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.041 kDa

MTYFVLFLGLCFVLGSLAVASNPSPYYGVVGLVLASIAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWGVVGYGVGFVAVLMVGLIVGGFVGSLDFGVATVDSVGMFSVRLNFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.145 kDa

MTYLVSLFLLGLVLGLVAVASNPAPYFAALGLVVAAGVGCGVLVGHGGSFLSLVLFLIYLGGMLVVFAYSAALAAEPFPESWGDRSVLGYVVVYTVGVVLVAGLFWGGWYETSWVAVDEFKEFSVLRGDTSGVALMYSHGGGMLIACAWVLLLTLFVVLELTRGLSRGALRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

173 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.445 kDa

MYVSMLFGFSYVFWLIGVSSNISVYYGVVSLVCTAGTGCVVLAWKGGSFLALVLFLIYLGGMLVIFAYSITLVMEPFPEVMGDWVGVMHAGKYVVLAVVFVLVGWGWWGVGECGDGVVDAGGLSIVRVDSSGLSLLYAIGGGALMMAMFGLFLTFFIVLVLVQGLFRVACPTI

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

172 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

17.972 kDa

MTYFMFLLLMALVVGLVAVASNPTPYFAALGLVVAAGVGCGVLVGHGGSFLSLVLFLIYLGGMLVVFAYAALAAEPFPEAWGSRSVLGYVLVYLLGVGLVAGIFWGGWYEGSWVVVDGLKEFSVLRGDISGVAVMYSSGGGMLVICAWVLLLTLLVVLELTRGLSRGALRAV

mt-nd6

NADH-ubiquinone oxidoreductase chain 6

172 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.179 kDa

MAFYLSFLMAALVGGMIAIASNPAPYFAAFGLVVVAGVGCGILVSYGGSFLSLILFLIYLGGMLVVFAYSAALAAEPFPEAWGDRVVFWRVMVYGLVVIVAAGFLLTGDTGLLMSVDAFKEFSVIRADVSGVAMMYSSGGKMLVICAWVLLLTLFVVLEVTRGLSYGVLRAI

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

172 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.099 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGISFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGMGFVAVLVAGVVVGGFECWDLGMVTVDSVGMFSVRLDFGGVAMFYSCGVGMFLAAGWGLLLTLFVVLELVRGLTRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

172 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.187 kDa

MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCAWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGMGFVAVLVMGMVVGGFECWDLGVVTVDSVGMFSVRLDFGGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLTRGAIRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

172 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.463 kDa

MLSLVLCFFVMFLLGVAVVVLSPSPYFSALGLVFVAVSGCFIVLYHGGTFLSLVLVLLYLGGMMVVFVYSAALAADPYPEVLGGRVIWFFVICVLCICFAGYMSFNDFFLDVSVACEGADYTGGIFGAEWLGVTTFYEVGLILVLAGWALLVCLFSVLVVVRGVNRGALRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

171 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.317 kDa

MYVMFLLSILLVLGFVSISSKPSPIYGGVGLIVSGAVGCGIIMGFGGSFMGLMVFLIYLGGMLVVFGYTTAMATEEYPETWGSNVVIWGVVLLGVGMELFMVAWMVEYGGFGVGDVFGGVENWMIFESKEGGVIREDSLGVASLYNKASWFAAIAGWSLFISVLIVIEIIR

mt-nd6

NADH-ubiquinone oxidoreductase chain 6

170 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.768 kDa

MIYMVSVSMMVLVLGLVAVASNPSPFYAALGLVLAAGAGCLVIVSFGSSFLSIVLFLIYLGGMLVVFAYSAARAKPYPEAWGSWSVVFYVLVYLIGVLVWYLFLGGVEVDGMNKSSELGSYVMRGDWVGVALMYSCWWVIIVYWWVSIIINFVCGIWVNSKSMWWESSCV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

168 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.708 kDa

MKMMTIYIISLLLMIGFVAFASKPSPIYGGLSLVVSGGLGCGMVVSLEDVFLGLVVFLVYLGGMLVVFGYTTAMATEEYPETWVGNVVAFIMLLFVLLLQVGWYFMSKLVYIIMAIKLFDFVETSLVGQDYNGVSQLYYCGGWALALLGWILFMTIYVVLEVVRERSY

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

167 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.008 kDa

MKMMVVFLFSILLVFGFVAFASKPSPVYGGLSLVVSGGLGCAIVVSLEDVFLGLIVFLIYLGGMLVVFGYTAAMATEEYPESWVGNTVALSMLLFTVIVESAWYLMSGEVKVSMDIELFDIIGGYCVGQDYSGVSLLYGCGGWALVLLGWILFITIYVVLEVVRGCN

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

167 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

17.899 kDa

MKIMMILEMLFLIGMVILVVDISPYFGALGLIVVSLVGCLIILAKGNSFLSLSLLLIYLGGMMVVFSYCTALVLDLYPTVIVKEVLMKMALGVLVVVFLGYGGYLKADNGVLSMLGEGGVDNSFLGAGVLYGESWLLIVFGCLGLFLALLVILEITKSAERGAYRVI

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

167 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.386 kDa

MVLMVVFSVMFLISLIAVASNPSPYFAAFGLMVGAGVGCGMLMQCGMTFLSMILFLIYLGGMLVVFAYSPALAAEPYPNAWGSWEVFSYVLVYMFLVIVAWVAFVGDMELFDDVEEYFGAMRRYVGVAEVYNAGGYMLFIAGWVLLMALLVVLELTRGYSRGCLRAV

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

166 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

17.983 kDa

MMYFIYLLSVMLVLSFMAFASNPSPIYGGLSLVLSGGVGCGIIVSLGGSFLGLIVFLVYLGGMLVVFGYTAAMATEEYPETWVDYTVVLNLAIMVGMLGVVWYEFFEEVDLGVGYDLLDLGGMEVLGGDFNGVSLLYACGGWELVFSGWILFLTIFVVLEVTRGEH

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

166 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

18.108 kDa

MNYFFSLVLVFLVLSVVVLGVVSAPYQGVVALMGVSFFCCIFMVFLGRTFAALVMYIVYLGGLVVVFGYCVSVEKESGIYSVGGTKYFIVCVSLLLVVLLCLLREVGGLLVYVNWGDLVCLEMNGVGVFYFSGGWGLIVCSWGLLVVLFSILVILSWSRLGGLRPF

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

166 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

17.876 kDa

MMYFVYLLSILLVLGFMAFASKPSPIYGGLSLVLSGGVGCGIVVSLGGSFLGLIVFLVYLGGMLVVFGYTAAMATEEYPETWVDSTVFTNLLIMVGMLGVIWYYFSGEVDLSINYDLLDLGGVEVLGGDYNGVSLLSACGGWELIFSGWILFLTIFVVLEVTRGEH

MT-ND6

NADH-ubiquinone oxidoreductase chain 6

81 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 6 family.

8.511 kDa

single

MTYFVFFLGICFVVGVLGVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVALVLFMVYFGGMLVVFVYSVALAAEPFPEA