MT-ND3

NADH-ubiquinone oxidoreductase chain 3

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.332 kDa

MNLLLTILFITTILSLILAIVSFWLPLMTPDYQKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWGDQLPSPMFTLLWASALLIMLTLGLIYEWLQGGLEWAEK

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.192 kDa

MNSFMVMIMLTLTLSSIMALLAFWLPIMKPDSEKLSPYECGFDPQGSARLPFSLRFFLVAILFLLFDLEIALLLPSPWATNISNPEFTLLWASLFVLLLTLGLIYEWLQGGLDWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.975 kDa

MNLILAGLLIMSILSMILAMIAFWLPNMTPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWADQLTNPTLALTWTTSIIALLTLGLIHEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.208 kDa

MINLIITLIINTALSTIIVLIAFWLPQLYLYLEKSSPYECGFDPLGSARLPFSMKFFLIAITFLLFDLEIALLLPLPWAMQLPTPNLTLILAYCLIILLTAGLAYEWIQKGLEWSE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.795 kDa

MNLITTIIAITITLSAVLATISFWLPQMTPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLTTPALTLAWSAAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.733 kDa

MNLITTIIAITITLSAVLATVSFWLPQITPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLATPALTLAWSAAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.087 kDa

MSLIMSSVVATALVSLILAFIAFWLPSLKPDNEKLSPYECGFDPLGSARLPFSMRFFLIAILFLLFDLEIALLLPLPWGNQLFSPFSTLLWTTTILVLLTLGLIYEWFQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.907 kDa

MNLIMSSVAATALISLILAFVAFWLPSLNPDNEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGNQLLTPSISLLWATSIIILLTLGLIYEWLQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.227 kDa

MNMITFMLLLSLTLSIILTTINFWLAQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQLSQPLLTLLWTSILLLLLTLGLVYEWIQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.097 kDa

MSLLMTIITITALLSTILAIVSFWLPQISPDHEKLSPYECGFDPMGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLPTPLLTFTWATAVLFLLTLGLIYEWIQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.908 kDa

MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLNTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.881 kDa

MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLSTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.88 kDa

MNLITTIITITITLSAVLATVSFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLNTPTLTLVWSTAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.864 kDa

MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLNTPALTLVWSTAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.931 kDa

MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLHTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.864 kDa

MNLVTTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLNAPTLTLLWSTAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.909 kDa

MNLITTIITITITLSAVLATISFWLPQISPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLDTPTLTLIWSTAVLALLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.071 kDa

MNLIMTILTITVALSLILATVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEWAE

mt-nd3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.111 kDa

MNLFATILIIMTTLSLVLALVSFWLPQMNSDTEKLSPYECGFDPLGSARLPFSLRFFLVAVLFPLFDLEIALLLPLPWGDQLNNPMETLFWAMTVLILLTLGLAYEWAQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.289 kDa

MINLIITLITNSLLSTIIIIIAFWLPQLYLYLEKSSPYECGFDPLGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQLPSPFTTLILSYCLIMLLTVGLAYEWIQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.94 kDa

MNLVISILAITIILSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLALPWGDQLYSATGTFFWATAVLILLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.045 kDa

MNLISTVILIASALSLILILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLSNPTLTFMWATSVLALLTLGLIYEWLQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.02 kDa

MNLIMTILTITAALSLILATVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILFLLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLILLTLGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

116 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.121 kDa

MNTLTFMLSLSFLLSAALTTMNFWLAQMAPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFDLEIALLLPLPWAIQLAHPMMTLTWATTIIALLTFGLIYEWTQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.099 kDa

MNLIMTLFINITLTSLLVLIAFWLPQLNIYTEKTSPYECGFDPMGSARMPFSMKFFLVAITFLLFDLEIALLLPLPWATQTVNLTTMLTTALLLISLLAVSLAYEWTEKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.946 kDa

MNLFIMLTMSSITVSIVVALNLLTAKTSPDPEKLSPYECGFDPLGSARLPLSIRFFMVGILFLLFDLEIAILLPLTWAIHTLNPLKTITWAIIIFLFLFIGLAYEWLQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.044 kDa

MNLSLTLMTDVALALLLVMIAFWLPQLNIYTEKYSSYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLKLMLTMALLLISILAAGLAYEWSQKGLEWEE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.12 kDa

MNLSLTFMTDVILALLLVMIAFWLPQLNIYTEKYSSYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLKLMLTMALLLISILAAGLAYEWSQKGLEWEE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.165 kDa

MNLMLTLITNISLSLVLITVAFWLPQLNVYTEKASPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAMQSTNLTMTLTFSFLFLTILALGLAYEWKQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.911 kDa

MNMALTLFTNTALASLLVLIAFWLPQLNTYSEKASPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASHTDNLTTMLTMALLLISLLAASLAYEWTEKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.058 kDa

MNMIMAMLANISISSCLIIIAFWLPHLNIYTEKASPYECGFDPMSSARLPFSMKFFLVGITFLLFDLEIALLLPLPWALHSTNMFLTTLTSFILVSVLALGLAYEWMNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.994 kDa

MNIMLTLLTNVTLASLLVLIAFWLPQLNAYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTNNLKTMLTMALFLLILLAASLAYEWTQKGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.226 kDa

MNMLMILSVNIILSTCLIMIAFWLPQLNVYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMHNINMMMSTAFILVSILALGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.189 kDa

MNLILMMILISSLISTILAIVAFWLPQMNPDMEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPLPWSTHLDPTLMLMWAFTIIILLTIGLIYEWLQGGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.183 kDa

MNFVLALTVNTLLALLLMTITFWLPQLYPYMEKSDPYECGFDPAYPARIPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMTTSSLMLIIILALGLTYEWSQKGLDWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.19 kDa

MNFVLALTINTLLALLLMILTFWLPQLNPYMEKSDPYECGFDPAYPARIPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMTTSSLMLIIILALGLTYEWSQKGLDWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.068 kDa

MNLMLVLLINTTISLVLVTIAFWLPQLNIYSEKSSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAAQFNNLNLVLIMALMLISILALGLAYEWIQKGLEWVE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.97 kDa

MNMMLAMLINITLSLCLISLAFWLPQLNLYSEKASPYECGFDPMSSARLPFSMKFFLVGITFLLLDLEIALLLPLPWAIQSTNMITTTIVSLSLVSILALGLSYEWMNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.266 kDa

MNMFIVMMINIILSMSLIIIAFWLPQLNLYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQIPNIKITMLTAFILVTVLALGLAYEWMQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.135 kDa

MNMLVALSVNIALSMCLITIAFWLPQLNMYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMNNINTMMLTSFILVSVLALGLAYEWMQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.939 kDa

MNMALTLFTNTALASLLVLIAFWLPQLNTYSEKVSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASHTDNLTTMLTMALLLISLLAASLAYEWTEKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.92 kDa

MNLVMALLTNTALASLLVLIAFWLPQLNSYAEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEVALLLPLPWATQTTNLKTMLIMALTLISLLAISLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.017 kDa

MNLMLTLLTNTLLASLLVLIAFWLPQLNIYAEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLIMALVLISLLAISLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.186 kDa

MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.053 kDa

MNLALALMINTLLALLLMTITFWLPQLNTYMEKTNPYECGFDPLSPARIPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNPSLTIASSLTLITILILSLAYEWSQKGLDWVE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.174 kDa

MNMLTALLINITLSLCLITIAFWLPQLNMYTEKASPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAMQINNIKVMMLTSFILVSVLALGLAYEWMQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.983 kDa

MNLPLALTTSITLTLLLVTIAFWLPQLNVYTEKYSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTNNLKLMLTVALVLITILAAGLAYEWLQKGLEWVE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.146 kDa

MNLMITLLTNTMLTSLMVLIAFWLPQTYNYSEKTSPYECGFDPVGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQANNTSLTLLMSFMLIILLAIGLAYEWLQKGLEWTK

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.15 kDa

MNLMATLLTNTMLTSLMVLIAFWLPQTYTYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQANNTNLTLLMSFMLIILLAIGLAYEWLQKGLEWTK

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.114 kDa

MNMFIVLLVNISLASCLILIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMSNIKATMLTSFILVSVLAMGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.994 kDa

MNFMLTLLTNTLLALLLVTIAFWLPQTNVYSEKSSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQANNLEVMLTTALLLISLLAISLAYEWSQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.045 kDa

MNLILTLLINTLLSSVLVLIAFWLPQLNIYTEKSSPYECGFDPMVSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLKTMLTMALILISLLAASLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.119 kDa

MNLIMVISINIILSSILILVAFWLPQLNSYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPIPWAIQTYNINTMLLAAFILVSILALGLAYEWKQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.103 kDa

MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.116 kDa

MNLFVALFINASLSFILISVAFWLPQLNIYTEKASPYECGFDPLSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQITKLSAMMITSFILISILALGLIYEWMNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.051 kDa

MNLLMALFIDASLSLILISIAFWLPQLNIYTEKAGPYECGFDPLSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQIPKLSAMMVTSFILISVLALGLMYEWMNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.847 kDa

MNLVIALLINTGLATILVMVAFWLPQLYTYLEKSSPYECGFDPLGSARLPFSMKFFLVAITFLLFDLEIAILLPIPWASQTSSPYSLLSLSGVLLALLTLGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.002 kDa

MNMLLIMLTNIVLSSLLISVAFWLPQPNSYVLKASPYECGFDPMSSACLPFSMKFFLVGITFLLFDLEIALLLPIPWAMQYTDTHLTMAASFILVSILTLGLAYEWLNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.209 kDa

MNMFMALSVNIILSTCLILIAFWLPQLNLYNEKANPYECGFDQSSTARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMYSINTMMLTAFILVSILALGLAYEWVQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.173 kDa

MNFVLILMTNTLLALLLMIITFWLPQLNSYMEKSNPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTANLPLMVMSSLLLITILALSLAYEWLQKGLDWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.16 kDa

MNFVLILMTNTLLALLLMIITFWLPQLNSYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTANLPLMVTSSLLLITILALSLAYEWLQKGLDWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.105 kDa

MNLMLALTVNTLLTALLTIIMFWLPQLNSYAEKANPYECGFDPLNPARIPFSMKFFLVAITFLLFDLEIALLLSLPWALQTANLPTMIKTSIMFITILALSLAYEWTQKGLDWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.013 kDa

MNMLTALSVNIALSTCLIAIAFWLPQLNLYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTNNINTMMLTAFILVSVLALGLAYEWMQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.149 kDa

MNMLLVLLVNSILSLLLILIAFWLPQLNMYNEKANSYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMTNINTMTLTSFILISVLALGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.226 kDa

MNMLMALMVNITLSILLITVAFWLPQLNMYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLYDLEIALLLPLPWAIQMYNTNTMMLTAFILVSVLALGLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.181 kDa

MNMLTALLVNITLSMLLIIVAFWLPQLNLYTEKANPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMYNIDIMMLTAFILVSVLALGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.166 kDa

MNMLMALLVNITLSTLLIIVAFWLPQLNLYTEKANPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMYNINIMMLTAFILVSVLALGLAYEWVQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.304 kDa

MNMLMVMLVNITLSSCLIMIAFWLPQLNLYTEKANPYECGFDPMSSARLPFSMKFFLVAITFFLFDLEIALLLPLPWAIQMYNINTMMLTAFILVSVLALGLAYEWMQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.217 kDa

MNMLTALLVNITLSMLLIIIAFWLPQLNLYTEKANPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMYYINIMMSTAFILVSVLALGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.266 kDa

MNMLTALLVNITLSMLLIIVAFWFFQLNLYTEKANPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMYNTNIMMLTAFILISVLALGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.101 kDa

MNMLTVLSVNIALSTCLITIAFWLPQLNLYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQMNNINTMMLTAFILVSVLALGLAYEWMQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.225 kDa

MNMMLILLMNIALAAILISLAFWLPHLNVYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAMQFPNMNMLMTMAFILITILALGLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.086 kDa

MITLHMVVLPFLITLFLLLIIKFLPMNVPDKEKLSPYECGFDPSGSARLPFSMKFFLVAILFILFDLEIILLFPLAWALNSQSHSNAIILASVFVIILTLGLIYEWLKGGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.051 kDa

MNMILTLFINITLSLCLISIAFWLPQLNAYTEKASPYECGFDPMSSARLPFSMKFFLVGITFLLFDLEIALLLPLPWAIHSTNSYLTMTVSFMLVSALALGLAYEWLNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.22 kDa

MNMLVTMLINTTLSFVLILIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPMPWAMQTQDIKTMTLTAFILLSVLALGLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.238 kDa

MNMLLAMLINITLSLLLISIAFWLPQLNIYTEKANPYDWGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPIPWAIQIHSINTMMLTAFILVTILALGLAYEWIQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.124 kDa

MNMLLTMLTNITLSTLLISIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPIPWAIQVKDINTMTLTAFILVSILALGLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.08 kDa

MNMLITMTVNSALSFCLISIAFWLPHLNIYTEKASPYECGFDPMSSARLPFSLKFFLVGITFLLFDLEIALLLPLPWAMHSPNTTTTMMVSFMFVSILALGLAYEWLNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.065 kDa

MNMLLVIAVNTILSLILITVAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPIPWAIQTPHINMVLPTALILLTILALGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.188 kDa

MNMLMVLTVNMMLSTCLILIAFWLPQLNLYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPLSWAIQMPNINIMTLTSFILVSVLALGLAYEWLQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.035 kDa

MNIMITLFINMSLASLLVLIAFWLPQLNTYTEKSSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWATQANTMTPMLTTALVLILLLALGLAYEWLQKGLEWNE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.022 kDa

MNLMLTLFTNATLASLLILIAFWLPQSYAYAEKVTPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQATNLNLVLFMALALITLLALSLAYEWIQKGLEWVE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.18 kDa

MNLMTTLLTNTMLTSLMVLIAFWLPQTYTYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQANNTNLTLLMSFMLIILLAIGLAYEWLQKGLEWTK

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.046 kDa

MNAIVILFINATLSLGLITVAFWLPHLNIYAEKAGAYECGFDPMSSARLPFSMKFFLIGITFLLFDLEITLLLPLPWAMHSTNTYFTMLVSFLLVSVLALGLMYEWTNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.031 kDa

MNLMLTLLTNTLLASLLVLIAFWLPQLNIYAEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLIMALILISLLAISLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.944 kDa

MNVMLALLTNTLLSTLLVLIAFWLPQLNIYAEKASPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTDKLPTMLTMALLLISLLAASLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.243 kDa

MNFALILMTNTLLALLLMIITFWLPQLNSYMEKTNPYECGFDPVSPARIPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILTLSLAYEWLQKGLDWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.155 kDa

MNMIMVISVNIILSSTLILVAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPIPWAIQMPDMKTMMLTAFILVSILALGLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.022 kDa

MNLLLTLLTNTTLALLLVFIAFWLPQLNVYAEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQSNNLNTMLTMALFLISLLAASLAYEWTQEGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.022 kDa

MNLLLTLLTNTTLALLLVFIAFWLPQLNVYAEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQSNNLNTMLTMALFLISLLAASLAYEWTQEGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.085 kDa

MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.085 kDa

MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I subunit 3 family.

13.055 kDa

MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.106 kDa

MNALLAILINITLSLTLISVAFWLPQPNHYTEKASPYECGFDPMSSARLPFSMKFFLIGITFLLFDLEIALLLPIPWAMQYENMHMTTSTAFALITILTLGLAYEWLNKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.01 kDa

MNVMLTLMTNVTLASLLVLIAFWLPQLNIYTDKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTNKLTTMLIMALLLISLLAASLAYEWTEKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

13.01 kDa

MNVMLTLMTNVTLASLLVLIAFWLPQLNIYTDKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTNKLTTMLIMALLLISLLAASLAYEWTEKGLEWTE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

115 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.981 kDa

MNLMLTLFINTSLASVLVLIAFWLPQLNIYTEKASPYECGFDPMGSARLPFTMKFFLVAITFLLFDLEIALLLPLPWASQTTNLKTMLTMALILISLLAASLAYEWTQKGLEWAE

MT-ND3

NADH-ubiquinone oxidoreductase chain 3

114 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.89 kDa

MNLITLIIMAMAMTTALYTINTYTTMKPDINKLSPYECGFDPLGNARTPISIQFFLVAILFILFDLEIVLLLPTPWSMNTNPSNTTILLITMLLTILTLGLLYEWLQGGLEWTE

mt-nd3

NADH-ubiquinone oxidoreductase chain 3

114 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 3 family.

12.924 kDa

MTATILMIAMTLSTILAILSFWLPQMTPDMEKLSPYECGFDPLGSMRLPFSMRFFLIAILFLLFDLEIALLLPFPWAAQLNTPSIVILWAALILTLLTLGLIYEWLQGGLEWAE