MT-ND2

NADH-ubiquinone oxidoreductase chain 2

349 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.853 kDa

MNPYVLTILLSSLGLGTILTFASSHWLLAWMGLEINTLAIIPIMAQQSHPRAIEATTKYFLTQATAAAMILFASTTNAWLVGEWEIHQLSHPLATTTVMLALALKLGLAPVHFWLPEVLQGLELTTGLILSTWQKLAPFALMIQVAPTINSSLLIAMGLLSTLVGGWGGLNQTQLRKILAYSSIAHLGWMVLILQYAPSLTLLSLFLYIIMTSSAFLTLKTNNSLTINTLATSWTKSPTLAALTALVLLSLGGLPPLSGFMPKWLILQELTKQGLPLSATLAAMTALLSLYFYLRLCYAMTLTIYPNTLTATAPWRLNFTLITLPLSIITILALGLLPLTPAVTTLLTL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

349 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.797 kDa

MNPYVLTILLSSLGLGTVLTFASSHWLLAWMGLEINTLAIIPIMAQQHHPRAIEATTKYFLTQATAAAMILFASTTNAWLVGEWEIHQLSHPLATTTVMLALALKLGLAPVHFWLPEVLQGLELTTGLILSTWQKLAPFALMIQVAPTINSSLLVTIGLLSTLVGGWGGLNQTQLRKILAYLPIAHLGWMVLILQFAPSLTLLSLSLYIVMTSSAFLTLKTNNSLTINTLATSWTKSPTLAALTALVLLSLGGLPPLSGFMPKWLILQELTKQGLPLSATLAAMTALLSLYFYLRLCYALTLTIYPNTLTATAPWRLNFTMITLPLSITTIMALGLLPLTPAVTAMLAL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.851 kDa

MNPYRRATLLCSVGLGTTLTFASSHWLLAWMGLEINTLAITPLMAQHHHPRAVEATTKYFLTQATAAAMILFASTTNAWMTGEWSINDLSNPIASTMFMAALALKIGLAPMHFWMPEVLQGLDLLTGLILSTWQKLAPLALIIQTAQTIDPLLLTLLGISSTLVGGWGGLNQTQLRKILAYSSIAHMGWMIIVIQYAPQLTLIALGTYIIMTSAAFLTLKMSLTTKISTLATTWSKSPILTSTTALVLLSLGGLPPLTGFMPKWLILQELTKQDLPIIATAMALTALISLYFYLRLLYAMTLTISPNMINSTTPWRTQTTQTSLPLALFTTAALGLLPMAPAILMLTT

mt-nd2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.721 kDa

MNPYVLMILMSSLGLGTTLTFSSSHWILAWMGLEINTLAIVPLMAQQHHPRAVEATTKYFLIQAAAAAMILFTSTTNAWISGQWDVTGMPGPATSTAMMFALALKIGLAPMHFWLPEVLQGLDLLTGLILSTWQKLAPMALIIQTTQTTDPLILTSLGIASSLIGGWSGLNQTQLRKILAYSSIAHMGWMIIVIQYAPQLTLIALGTYIFMTSAAFLTLKVLSATKINTLTTTWPKSPILAAIATLVMLSLGGLPPLTGFMPKWLILQELTKQDLPATATIMALTALLSLFFYLRLCHAMTLTTSPNTINSAPHWRVQTTQNSLPLTISVTVTMGLLPLTPAILMLTT

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.925 kDa

MNPYVLMILISSLGLGTTLTFASSHWLLAWMGLEINTLAILRLMAQQHHPRAVEATTKYFLTQATAAAMILFAATTNAWATGEWDINNLTHPLASSLTMMALALKVGLAPMHFWMPEVLQGLDLTMGLILSTWQKLAPFALITQMAPNTNPMLLTTLGLLSTLIGGWGGLNQTQLRKILAYSSIAHMGWMIIILQYTPQLTLIALGLYIFMTSAAFLSLKMASATKMNTLTAAWSKSPVLVSTTALTLLSLGGLPPLTGFMPKWLILQELTKQDLPATATIMALAALLSLYFYLRLSYAMALTIYPNTTNALTPWRTNTTQSTLALALMMIGALGLLPLTPTIMALFF

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.893 kDa

MNPFILSILLLSLGLGTTLTFASSHWLLAWMGLEISTLAIIPLMSQHHHPRAVEATTKYFITQAAAAALILFASTTNAWITGQWDINFDLHFFPASMLTMALALKMGLAPVHFWLPEVLQGLDLTTGLILSTWQKLAPFILMCQIMPVNSSLITFLGVTSTLVGGWGGLNQTQLRKILAYSSIAHLGWMILVMQFNQQLALLALIIYIPMTFSTFMIFKTNSSTTVNTLAASWAKTPALTAITPMILLSLGGLPPLSGFMPKWMILQELTKQDIPLTASIAALSALLSLYFYLRVSYAMTLTISPNNLNATTPWRLQTTASTLPLAISATISAMLLPLAPATLALLSL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.165 kDa

MSPYVTMILISSLGLGTTITFTSSSWLMAWMGLEINTLAITPLMVKQHHPRATEATTKYFLTQATASGLLLFATLNNAWMTGEWNTMELSNNLSAPMITMALALKMGVAPMHFWLPEVLQGLPLLTGLILSTWQKLAPFTLLYMTSHELNTTTMTILGLTSTIIGGLGGLNQTQLRKVLAYSSIAHLGWMVIIIQYSKTLALLNLLLYITMTSTAFLTLMTLSATKINTLSTKWATTPIATMTAMLALLALGGLPPLTGFMPKWLILQELTKQNLPALATLMALSALLSLFFYLRMCHTMTLTISPNTNNNMITWRKKPGQKALPLAMLSIMTLMALPTTPTMVAIMN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.86 kDa

MSPYVFLIISISLFLGTSLTLFSNHWLMAWMGLEINTLAIIPMMTYPNHPRSTEAAIKYFLTQATASMLVMFAIIHNAWMTNQWTLFQMANSAASVLMTLALAMKLGLAPFHFWVPEVTQGIPLSSGMILLTWQKIAPTALLYQISPTLNMKVLITLAFLSTMLGGWGGLNQTHLRKILAYSSIAHMGWMTIVMMINPSLALLNLLIYIIATLTLFLMLNFASVTKIKSLTNLWNKSAPMTTAILLTLLSLGGLPPLTGFMPKWLILQELVSNNNIIMATLMALSALLNLFFYMRIIYASTLTMFPTTNNSKIQWPYPQTKTINIIPTLTIISSLLLPLTPLLTTLMY

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.879 kDa

MNPYVLMILLSSLGLGTTLTFASSHWLLAWMGLEINTLAITPLMAQHHHPRAVEATTKYFLTQATAAAMILFASTTNAWMTGEWSITDLSDPLANTMFMTALALKIGLAPMHFWMPEVLQGLDLLTGLILSTWQKLAPFALIIQTAQNIDPLLLTLLGVTSTLVGGWGGLNQTQLRKILAYSSIAHMGWMIIVIQYAPQLTLLALGTYIIMTSAAFLTLKMSLTTKVSTLATTWSKSPILTATTALVLLSLGGLPPLTGFMPKWLILQELTKQDLPIIATTMALAALISLYFYLRLCYAMTLTISPNTTNSTTPWRTQTTQASMPLALFTMATLGLLPMTPAILTLTT

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.136 kDa

MNPTVLTIIISSMGLGTTLTFIGSHWLLVWMGLEINTLAIIPLMIRQHHPRAVEATTKYFITQATASALLLFASVTNAWTSGEWSLIEMLNPTSATLATAALALKIGLAPLHFWLPEVLQGLDLTTGLILATWQKLAPFAILLQLSPLLNSNLLLLFGVTSTIVGGWGGLNQTQLRKILAYSSIANLGWMITILHYSPSLTLLNLILYMFMTLTTFLLFKTFNSTKINSISSSTLKSPLMSVIALMTLLSLGGLPPLSGFMPKWLILQELTKQSLIIPATIMALMALLSLFFYLRLCYATTLTKAPGPINMASTWRTKSHQPTLILLTSASISIFMLPMTPLILMLMT

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.341 kDa

MNPVVLTIIISSLGLGTMMTFIGSHWLLVWMGLEINTLAIIPLMIRQHHPRAVEATTKYFLTQATASALLLFASITNAWSLGEWSLLEMLNPTSATLVTIALALKIGLAPMHFWLPEVLQGLDLITGLILATWQKLAPFAILLQLHPMLNSNLLLFLGVSSTVIGGWGGLNQTQLRKILAYSSIAHLGWMITILHYSPNLTQLNLALYIIMTLTTFLLFKLFNSTKINSIAISTIKSPLLSIIALITLLSLGGLPPLSGFMPKWLILQELTKQDLAIPATIMALAALLSLFFYLRLCYSTTLTMSPNSIYLSSSWRTKSLQPNLILMMATSLSILLLPLTPTIFMLTL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.952 kDa

MSPYITASLLFGLLLGPTITATSSHWLIAWMGLEINTLAIIPLMAQHHHPRAVEATTKYFLTQATAAAMLLFASTTNAWLTGQWELQQMTHPLPSTLIILALALKIGLAPLHTWLPEVLQGLDLTTGLILSTWQKLAPFALLLQLQPNNPTLLVILGVLSTLIGGWGGLNQTQLRKILAYSSIAHLGWMILILQFSPTLTLLTLMLYLIMTSSAFLTFILNKTTTINALATSWAKTPILTSLLPLVLLSLGGLPPLTGFMPKWLILQELTKHDLAPTATLAALSALLSLYFYLRLSYAMTLTIAPNNLTGTLPWRTQTTQPNMMTATMAASSILLLPMTPGILTLFNI

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.256 kDa

MNPIIISMIGFTIILGTTIVLMSSHWFMIWIGFEMNMLAIIPVLMKSHHPRSTEASTKYFLTQTTASMLMLLSVMINLIYTGQWTAMKLANPTASTIMTLSLAMKLGLSPFHFWVPEVTQGIPLTSGLILLTWQKLAPLSVLYIASPNLNMTMLLTMSILSVVMGGWGGLNQTQLRKILAFSSIAHMGWMTAIIMFNPTLTLLNLLLYILMTTTIFMILIFTKSTTTLSISYMWNKTPIMTVIMLTILMSLGGLPPLSGFMPKWMIIQELTKNNNIALALIMAMSALLNLYFYMRLMYATTLTMFPSSNNIKMKWYYTNNLPTKYLPTLTIMSTLLLPLTPMMMMLLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.789 kDa

MMTLILILGIFLGTMTTMFSSSWFFAWLGLEINMMAIIPMMLFPLSQRALESSMKYFISQAVASSTIILASSWNYFSSGQWTISFMSDNLAITLIILALLLKLGLAPLHFWLPEVLQGVNLHMGLIISTWQKLAPLTLLIQVSSNLNNMYILISISVMSVLAGGFGGLNQTQLRKLLAYSSISHMGWIVGVMAVSASLSWVTTVIYLIINFSIFTILIELNSTKISDLMLSWSKTSWSHTKCILVLLSLGGLPPFTGFFLKLSISNALISNSLILMTILLMAGSLISLFFYLRLSFMTALLLAPTNLQIKGTWKSPHYSNLLFNLMFLFSILLLPLSPFMISLFQISW

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

348 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.912 kDa

MNPLAQLIIYTTVITGTLITMLSSHWFLAWAGLEMNMLAFIPTLIKKTNARSTEAATKYFLAQSTASMILMMAIISNNLLSGHWTTTTNYTNQFPPLAMTIALTMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQIHPSINTHILLILSTLSIAVGSWGGLNQTQLRKILGYSSITHTGWMMMTLTYNPTITTLYLITYITLTTTMFLTLNLNSSTTTLTLSNTWNKSTHLMPLMTSTLLSLGGLPPLTGFLPKWVTIQELTMNNNFIIPTIMITMTLLNLYFYMRLIYTISLTLLPTSNNTKMTWQFENTKPTLFIPALITISTLLLPISPLILSIP

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.798 kDa

MNPLIFPIIMLTIMLGTLIVMISSHWLMIWMGFEMNMLAVIPVLMKQYNPRSMEAATKYFLTQATASMLLMLAIVINLLHSGQWTFTKLMDPTASIIMTLALTMKLGLAPFHFWVPEVTQGVSLTSGLVLLTWQKLAPLSVLYTIAPVINSDLILTMSILSIMIGGWGGLNQTQLRKILAYSSIAHMGWMTSVLIFNPTMTLLNLLLYILMTSTTFALFMTVSTTTTLSLSHAWNKTPLITTSILIMMLSLGGLPPLTGFLPKWMIIQELTKNDNIILATLMAIAALLSLFFYMRLTYATSLTMFPTTNNMKIKWQFNKIKQMKCLSPLIILSTLTLPLAPAMMILN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.409 kDa

MLSPLIQSTLLMTLGLGTLVTFSSTSWILAWIGLEINTIAIIPLMAKTHHPRSIEATTKYFIAQSAGSATLLITACLTAWYSGNWAISPSNDPIILNAMTLALMLKLGMAPMHFWLPEVMVGLDFITGMILATWQKLAPITLLIQIAQDQNNMFILIPALLSVFVGGWGGLNQTQTRKILAYSSIAHMGWITSMAPFNPTITWLTTLIYCLITSATFINLHILKANKITALTMNKHNQISQMLLLLLLLSLGGLPPLTGFINKLLASIELANQNLIIYLFMMMMGSLLSLFFYTRMCYLSIILSPPCSTTNLILWRVVSNKPMTLITMLSTNLFIMTPQLLAVFTLH

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.789 kDa

MKPPILIIIMSTVMSGTMIVLTSSHWLLTWIGFEMNMLAIIPILMKNHTPRATEASTKYFLTQATASMLLMMGIIINLMFSGEWTISKIPNPIASGLVTIALTMKLGMAPFHFWVPEVTQGISLSSGMILLTWQKIAPLSVLYQISPSINPKLLITMAIASVLIGGWGGLNQTQLRKILAYSSIAHMGWMTVILTYNPTLMVLNLTIYITMTLSTFMLFMHNSSTTTLSLSNTWNKLPLMTSLILMLMMSLGGLPPLSGFAPKWMIIQELTKNDMIILPTFMAITALLNLYFYMRLSYSTALTMFPSVNNMKMKWQFESAKKIILLPPLIIISTMLLPMTPMMSILE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.056 kDa

MNPIIYTTLIMTVMSGTMLVMISSHWLLIWIGFEMNLLAMIPVLMKNFNPRATEAATKYFLTQATASMMLMMAIIINLLYSGQWTITKMFNPVAMTMMTMALAMKLGLSPFHFWVPEVTQGISLQAGLLLLTWQKLAPLSVLCQISQSINPNLMLTMAMLSILIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLPYNTTMTILNLLIYITMTLAMFMLLIHSSATTTLSLSHTWNKMPVITSLMMVTLLSMGGLPPLSGFMPKWMIIQEMTKNESIIMPTLMAMTALLNLYFYMRLAYSSSLTMFPSTNNMKMKWQFEHTKQMKLLPTMIVLSTLVLPMTPALSSLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.619 kDa

MNPLAQPIIYPTIFTGTLITALSSHWFFAWLGLEMNMLAFIPVLTKKTSPRSTEAAIKYFLTQATASMILLMAILYNNMLSGQWTTTNTTNPYSSLMIVTALAMKLGMAPFHFWVPEVTQGVPLTSGLLLLTWQKLAPISIMYQMSSSVDTNILLTLSILSILVGGWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPDITILNLIIYIILTTTAFLILDLNSSVTILMLTRTWNKLTWLMPLIPSTLLSLGGLPPLTGFLPKWAIIEEFAKNGNLITPTIMAIITLLNLYFYVRLIYATSITLLPMSNNAKMKWQFENTKPTPLLPTLTILTTLLLPISPLILSIS

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.681 kDa

MNPLAQPIIYLTVFTGTLITALSSHWFFAWLGLEMNMLAFIPVLTKKTSPRSTEAAIKYFLTQATASMIFLMAILHNNMFSGQWTTANTTNPYSSLMIVTALAMKLGMAPFHFWVPEVTQGVPLTSGLLLLTWQKLAPISIMYQMYPSVDTNILLTLSILSILVGSWGGLNQTQLHKILAYSSITHMGWMVAVLPYNPNITILNLIIYITLTTTTFLILDLNSSTTILLLSRTWNKLTWLMPLISSTLLSLGGLPPLTGFLPKWAIIEEFAKNDNLIAPTIMAIISLLNLYFYARLIYITSITLLPMSNNVKMKWQFENTKPAPLLPTLTILTALLLPISPLILSIP

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.72 kDa

MKPPILIIIASTIISGTIVVMMSTHWLMTWIGFEMNMLAVIPILMKNFTPRSMEAATKYFLAQATASMILMLGIITNLLLTGQWTMLNNQNQIASNMMTIALTMKLGLSPFHFWVPEVTQGVSLSSGMILLTWQKIAPLSVLHQISPSINPNLLAIAAIASILVGGWGGLNQTQLRKILAYSSIAHMGWMAAVTTYNPDLMTLNLMMYIVMTLSTFMLFMYSSSTTTLSLSHAWNKFPLITSLILMLMMSLGGLPPLSGFIPKWMIVQELTKNDMIIMPTLMAMMALLSLFFYMRLTYATALTLFPTTNNMKMKWQFESTKKMILLSPAIVISTMMLPLTPMMSILN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.652 kDa

MNPLVFTVIMSTVMLGTAIVATSSHWLMAWIGFEMNMLAVIPILMKKYNPRSMEASTKYFLTQATASMLLMLAVTMNLVYSGQWSVTKPLSPTASTIMTLAMAMKLGLSPFHFWVPEVAQGISLPSGLILLTWQKLAPMSILYQISSTINLDLLMTLSILSIGIGGWGGLNQTQLRKIMAYSSIAHMGWMTTILAYNPTMTLLNLAIYILLTTTTFMMFMLSSTTTTLSLSHTWNKMPLLTTAILLTMLSLGGLPPLSGFMPKWMIIQELTKNDNVILPTMMAVMALLNLYFYMRLTYSTSLTMFPSTNNMKMKWQFNYAKSTTHLSPLIILSTLILPLSPMLALLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.882 kDa

MNPLVFTMIMSTVMLGTAIVATSSHWLMAWIGFEMNMLAVIPILMKKYNPRSMEASTKYFLTQATASMLLMLAVTMNLVYSGQWSITKPLNPTASTIMTLAMAMKLGLSPFHFWVPEVTQGISLPSGLILLTWQKLAPMSILYQISPPINLDLLMMLINLSIAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAILTYNPTMTLLNLMIYILLTTTTFMMFMLSSTTTTLSLSHTWNKMPLLTTAILLTMLSLGGLPPLSGFMPKWMIIQELTKNNSVIMPTTMAVMALLNLYFYMRLTYSTSLTMFPSTNNMKMKWQFNYTKSTTHLSPLIILSTLILPLSPMLALLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.908 kDa

MNPLTLIIIMFTLFMGTMITVFSSHWLTMWIGLEMNMLAIIPILINKATPRSTEAATKYFLTQATASMILMMAITLNILDSGQWTLINPQNQLTPVLITLALIIKLGMAPFHFWVPEVTQGVPLKSGLILLTWQKLAPLSILYQISPSINPTMMMSVAILSIMVGGWGGLNQTQLRKILAYSSIAHMGWMAAIITFNPNTMVLNLIIYILMTIPMFMMFMQHSSTTTLSLSQMWNKNPLMVSTILITLMSLGGLPPLTGFIPKWIIIQELTKNGNIILPTAMAMLALLNLYFYMRLIYSSSLTMFPTTNNLKMKWQFESTKRMPLITPLIILSTMLLPLTPALSVLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.956 kDa

MNPIVFSTILTTAIMGTVIVMMSSHWLMVWIGFEMNLLAIIPILMKKFNPRAMEASTKYFLTQATASMLLMSAIIINLMHSGQWTITKMFNPTASAIMTSALIMKLGLSPFHFWVPEVTQGISLMSGLILLTWQKLAPMSILYQIAPSINLDMLMTSALLSILVGGWGGLNQTQLRKIMAYSSIAHMGWMTAILTYNPTMTMLNMLIYIMMTLTTFMLLMLNSSTTTLSLSHTWNKTPLITSLILIIMLSLGGLPPLSGFIPKWMIIQELTKNNSIILPTSMAIMALLNLYFYLRLTYSTSLTMFPSTNNMKMKWQFENSKQMSLLPTLIIMSTLLLPLMPTMSILN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.93 kDa

MNPLIFTLITSTIVLGTMIVMTSSHWLMIWMGFEMNMLAIIPMLMKQYSPRSMEAATKYFLTQATASMLLMLAIIINLVYSGQWTFTKLMNPTASIIMTVALAMKMGLAPFHFWVPEVTQGISLLSGLILLTWQKLAPLSVLYVISPIINLDLLLTMSILSILIGGWGGLNQTQLRKILAYSSIAHMGWMTSILIFNPMMTLLNLSLYILMTATTFTLFMTTSTTTTLALSHTWNKMPLITSSTLIIMLSLGGLPPLVGFLPKWMIIQELTKNNNIILATLMAITALLNLFFYMRLTYATSLTMFPTMNNMKIKWQFNHTKQTKCLPMLIVLSTMTLPLAPAMILLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.862 kDa

MNPLIFTMIMLTVILGTTIVMMSSHWLMIWMGFEMNMLAVIPLLMKQYNPRSMEAATKYFLTQATASMLLMLAVIINLLYSGQWTFTKLMNPTASIIMTLALGMKMGLAPFHFWVPEVTQGISLSSGLILLTWQKLAPLSVLYVISPAINLDLILLMSMMSIAIGGWGGLNQTQLRKILAYSSIAHMGWMASILVFNPTMTLLNLLLYILMTTTTFMLFMVASATTTLSLSHMWNKMPLITTSTLTIMLSLGGLPPLTGFLPKWMIIQELTKNNNITLATLMAITALLNLFFYMRLTYATSLTMFPTTNNMKMKWQFNNKKQLKCLPVLIILSTITLPLAPAITLLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.919 kDa

MNPLILIMIMLTVILGTTIVMMSSHWLMIWMGFEMNMLAVIPLLMKQYNPRSMEAATKYFLTQATASMLLMLAIIINLLYSGQWTFTKLMNPTASIIMTLAMAMKMGLAPLHFWVPEVTQGISLSSGLILLTWQKLAPLSVLYVISPGINLDLILLMSMMSIAIGGWGGLNQTQLRKILAYSSIAHMGWMASILAFNPTMTLLNLLLYILMTTTTFMLFMATSATTTLSLSHMWNKMPLITSSTLTIMLSLGGLPPLVGFLPKWMIIQELTKNNNITLATLMAITALLNLFFYMRLTYATSLTMFPTMNNMKIKWQFNNKKQMKYLPMLIILSTITLPLAPAITLLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.708 kDa

MKPPILITIMLTVVSGTMIVLTSSHWLTVWIGFEMNMLAIIPILMKKSNPRAIEASTKYLLTQATASMILMMGVAIDLLYSGQWTMSKTLCPMASAMMTIALAMKLGLAPFHFWVPEVTQGIHMSSGLILLTWQKIAPLSILYQISPTINPNLLLPMAIASVLIGGWGGLNQTQLRKILAYSSIAHMGWMAAITLYNPTMMILNLTIYIIMTSTTFMLFMYNSSTTTLSLSQTWNKAPLITSLILMLMLSLGGLPPLSGFIPKWMIIQELTKNEMIIVPTLLAMTALLNLYFYMRLTYTTTLTMFPSTNNMMMKWKFNNTKKMTLLSPLIVVSTMLLPITPLLSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.329 kDa

MNPLIFIIIMFTLILGTVITMISSHWLLIWMGLEMNMFSMIPIIMMKSHPRSTEAATKYFMTQATASMLLMMGVIINLYYSGQWTIMNSLNPVTSYMMTIALAMKLGLAPFHFWVPEVTQGTQLTSGMILLTWQKLAPMTILYQIHSSLNLNLMLTLAILSILIGGWGGLNQTQLRKIMAYSSIAHMGWMTAIIMYNTSLMMLNLVIYLMMTITMFALFINSTTTTTLSLSLTWNSTPILTTMLLTTLLSLGGLPPLSGFAPKWMIIQEMTKNNMLLLPTTMAIMALLNLYFYMRLIYSTSLTMFPTTNNNKMKWKYKTQNFIPLSPTLITLSTMLIPLTPMMLILN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.734 kDa

MSPYVLTIMSFSLLLGTTMTLISNHWLTAWMGLEINTLAIIPLMTKPHHPRSMESAIKYFMIQATASMIILFSAIFNASTTNQWMTGQISNTSASFMMTIALAMKLGLAPFHFWVPEVTQGIPLLSGMLLLTWQKIAPISIFYQISPSLNMSLLMILSITSTLLGGWGGLNQTQLRKILAYSSIAHMGWMAIIIMIYPSLTILNLILYLASTITMFMVLNQSSSTKINSLSILWNKSAPNMIIITLTLLSLGGLPPLTGFMPKWLILQELINFNNIPLAMMLALSTLLNLFFYMRIIYSSTLTMFPSINNTKMQWTLYSHKTISPIPTLTIISSLLLPMTPVFITLS

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.852 kDa

MNPAIFTTIILTMILGTMIVTTSSHWLTVWIGFEMNMLAIIPILMKKYNPRSMEASTKYFLTQATASMLLMLAITINLVYSGQWSVTKPLTPMASITMTLAMAMKLGLSPFHFWVPEVTQGTQLSSGLILLTWQKLAPMSILYQISPTINLELLLMMAILSIAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAIMAYNPAMTLLNLXVYILLTTTXFMMLMLNSSTTTLSLSHTWNKTPLLATTILLIMLSLGGLPPLSGFXPKWMIIQEMTKNDSIIMPTIMAMAALLNLYFYMRLTYSTSLTMFPSTNNMKMKWQFNSTKPMTYISPLIILSTLXLPLSPMLTLLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.785 kDa

MNPLILSMILTTLAMGTMATMLSSNWLLAWMGLEMNMLAMIPILTMNPNPRSTEAATKYFLTQATASMLLMMAIMINFMLSGQWSITKLPNTTVSSMALAALMMKLGLAPFHFWVPEVTQGTSLTSGMILLTWQKLAPLSILYQIDTSVDITILTVSGLLSILVGGWGGLNQTQLRKILAYSSIAHMGWMLIIMPYNPSLTILNLLIYILMTLSIFMIMMNNHSTSTLTLALLWNKAPMMMILLTITLLSLGGLPPLSGFMPKWLIIHELTKNDSIILPMSMAMFALLNLYFYMRLIYSSSLTMFPSTNNMKMKWHFTNRSHLTLLPPLIILSTLTLPLTPFLSILE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.53 kDa

MNPLTFAMILLTIMLGTTIVMTSSHWLVVWIGFEMNMLAVIPVLMKKYNPRSMEAATKYFLTQATASMLLMLAIVINLIYSGQWSTTNPLNPTASIIMTLALAMKLGLAPFHFWVPEVTQGIQLSSGLILLTWQKLAPISILYQISSTTNLNLLLAMSILSVAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAIMVYNPTMALLNLVIYILLTTTTFSVFMLNSSTTTLSLSHMWNKTPLLTTALLMTMLSLGGLPPLSGFLPKWMIIQELTKNNSVIVPTTMAITALLNLYFYMRLTYSTSLTTFPSTNNMKIKWQLNNTKPTIHLSPLIILSTLILPLSPILTLLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.988 kDa

MNPLALSLILTTLFTGTLITMMSSHWLTAWMGLEMNMLTMIPILMKTTNPRSTEAATKYFMTQATASMMLMMALTINLMYSGQWSITKMTNPVASNVALMALMTKLGSAPFHFWVPEVTQGVELTPGMILLTWQKLAPLSLLYQMATYTNTNLIYLSGLLSILIGGWGGLNQTQLRKILAYSSISHMGWMLIILPFNPTLTLLNLAIYILLTLSIFMILANTFTTSMSSLTLMWNKTPAMTIMLMTTLLSLGGLPPLSGFTPKWLMIHELTKNNSIIMPLTMAIMTLLNMYFYTRLIYYSSLTILPSTNNMKMTWQFTNTKHTMMLPTLITLSNMLLPLTPMISMLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.182 kDa

MNPPIFIIIMLTVISGTMIVVTTSHWLLVWIGFEMNLLAIIPILMKKYNPRAMEAATKYFLTQAAASMILMMWIIINLLHSGQWTVLKDLNPMASIMMTTALAMKLGLAPFHFWVPEVTQGISMSSGLILLTWQKIAPLSILYQISSTINPNLILTMSILSVMIGGWGGLNQTQLRKIMAYSSIAHMGWMTAIMMYSPTMMILNLTIYIIMTLTTFMLFMHNSTTTTASLSQTWNKTPLITSLILVLMMSLGGLPPLSGFIPKWMIIQELTKNELIMMPTLLAMTALLNLYFYMRLTYTTALTMFPSNNSMKMKWRFECTKKMTFLPPLVVMSTMLLPLAPMLSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.906 kDa

MNPSIFIILLTTLILGTMMVITSSHWLLAWIGFEMNMMAFIPIMMKNPSPRATEASTKYLLTQATASALLMMAVIINLMYSGQWTITKLFNPTASTLMTVALAIKLGLAPFHFWVPEVTQGIPLTTGLILLTWQKLAPLSILYQISPSINLYLMLTMSLLSILVGGWGGLNQTQLRKIMAYSSIAHMGWMTTILPYNPTLTLLNLLIYITMTFTMFMLFIQNSTTTTLSLSQTWNKTPIITTLTMLTLLSMGGLPPLSGFMPKWMIIQELTKNDILIMPTFMAITALLNLYFYMRLTYSTALTLFPSTNNMKMKWQFSPTKRAPLLPTAIVISTMLLPLTPMLSILL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.925 kDa

MNPLILIILLTTLILGTMMVVTSSHWLLAWIGFEMNMMAFIPIMMKNPTPRATEASTKYLLTQATASALLMMAVIINLMHSGQWTITKLFNPTASTLMTVALAIKLGLAPFHFWVPEVTQGIPLTTGLILLTWQKLAPLSILYQISPSINLHLMLIMSLLSILMGGWGGLNQTQLRKIMAYSSIAHMGWMTAILLYNPTLTLLNLLIYITMTFTMFMLFIQNSTTTTLSLSQTWNKMPVITTLTMLTLLSMGGLPPLSGFMPKWMIIQELTKNDMLIVPTFMAITALLNLYFYMRLTYSTALTLFPSTNNMKMKWQFNSTKRTPLLPTAIVISTMLLPLTPMLSILL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.98 kDa

MNPYIFFIIMSTVMLGTLIVMTSTHWLLVWMGFEMNMLAIIPLLMKQYNPRSMEAATKYFLTQATASMLLMLAIMINSLYSGQWTFTKLMNPTASVIMTLALTMKLGLAPFHFWVPEVTQGISLPSGLIMLTWQKIAPFSGLYTLAPIINLDLLLVVSILSVAIGGWGGLNQTQLRKIMAYSSIAHMGWMTSILVFNPTMTLLNLFLYVLMTTTTFMLLMAASTTTTLSLALMWNKMPLITTSTLAMMLSLGGLPPLTGFMPKWMIIQELTKNNNIILATLMAITALLNLFFYMRLAYTTSLTMFPTTNNMKMKWQLNTTNQTKYLPLLIIMSTMTLPLTPTMVLLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.934 kDa

MNPLIFTTIVLTIIMGTMIVMTSSHWLTVWIGFEMNMLAVIPILMKNYNPRSMEASTKYFLTQATASMLLMLAIIINLLYSGQWSITKPLNQTASIIMTLAMAMKLGLSPFHFWVPEVTQGIQLSSGLILLTWQKLAPMSILYQIFPTINLNLMLLMSVLSVAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAIMAYNPTMTLLNLVIYILLTTTTFMMFMLNSSTTTLSLSHTWNKAPLLTMTILTIMLSMGGLPPLSGFLPKWMIIQEMVKNDNIITPTIMAVTALLNLYFYMRLTYSTSLTMFPSTNNMKMKWQLNNTKSTAHVSPLIILSTLALPLSPILMLLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.254 kDa

MNPIIFIIILLTIMLGTIIVMISSHWLLVWIGFEMNMLAIIPIMMKNHNPRATEASTKYFLTQSTASMLLMMAVIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQIFPSINLNLILTLSVLSILIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLPYNPTMTLLNLIIYIIMTSTMFTMFMANSTTTTLSLSHTWNKTPIMTVLILATLLSMGGLPPLSGFMPKWMIIQEMTKNNSIILPTFMAITALLNLYFYMRLTYSTTLTMFPSTNNMKMKWQFPLMKKMTFLPTMVVLSTMMLPLTPMLSVLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I subunit 2 family.

39.254 kDa

MNPIIFIIILLTIMLGTIIVMISSHWLLVWIGFEMNMLAIIPIMMKNHNPRATEASTKYFLTQSTASMLLMMAVIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQIFPSINLNLILTLSVLSILIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLPYNPTMTLLNLIIYIIMTSTMFTMFMANSTTTTLSLSHTWNKTPIMTVLILATLLSMGGLPPLSGFMPKWMIIQEMTKNNSIILPTFMAITALLNLYFYMRLTYSTTLTMFPSTNNMKMKWQFPLMKKMTFLPTMVVLSTMMLPLTPMLSVLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.933 kDa

MKPPIFIIIMSTVISGTVIVMTSSHWMLTWIGFEMNMLAIIPILMKKFNPRAMEASTKYFLTQATASMLLMMGIIINLLHSGQWTVSNNLNPMASILMTTALAMKLGLAPFHFWVPEVTQGISLSSGMILLTWQKIAPLSILYQISPTINPHLLLPMAILSVLIGGWGGLNQTQLRKIMAYSSIAHMGWMAAILLYNPTMMFLNLIIYITMTLTTFMLFMLNSATTTLSLSQTWNKAPLITSLILTLMLSLGGLPPLSGFTPKWMIIQELTKNEMIILPTFLAITALLNLYFYMRLTYATALTMFPSTNNMKMKWQFESTKKTIFLPPLIIISTMMLPLTPMISILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.766 kDa

MKPPILIAILATVMTGTMIVMLSSHWLLIWIGFEMNMLAIIPILMKKFNPRAMEASTKYFLTQATASMLLMMGVTINLLYSGQWMISKVSNPAASTMMTIALTMKLGLSPFHFWVPEVTQGISLSSGMILLTWQKIAPMSVLYQISPSINTDLMTLVALASVLVGGWGGLNQTQLRKIMAYSSIAHMGWMAAIIIYNPTMMFLNLSLYILMTLSTFMLFMLSASTTTLSLSHTWNKIPLIASTILTLMLSLGGLPPLSGFIPKWMIIQELTKNDMIVVPTLMAITALLNLYFYMRLTYSTALTMFPSANNMKMKWQFEHTKKMTLLPPLIITSTMLLPIMPMMSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.036 kDa

MNPIIFFMIMLTIILGTTIVMTSSHWLTVWMGFEMNMLAIIPMLMKNHHPRSTEAATKYFLTQATASMLLLLAITINLMSSGQWTVTNMINPTSSIILTIALAMKLGLAPFHFWVPEVTQGTPLSSGLILLTWQKLAPLSILLTMSPIINLDLLLMMGLLSVMIGGWGGLNQTQLRKIMAYSSIAHMGWMVTILIYNPTLTMLNLTIYIMMTLTMFMLLITTSTTTTLSLSHAWNKMPLITTMMLTTLLSMGGLPPLTGFMPKWMILQELTKNNSIILPTFMAITALLNLYFYMRLTYSTSLTMFPTTNATKIKWPFMTTKQMTYLSPLMVISTMTLPLTPMMMILH

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.101 kDa

MKPPIFFLIMSTVISGTLIVMTSSHWMLTWIGFEMNMLAIIPILMKKFNPRSMEASTKYFLTQATASMLLMMGIIINLLYSGQWTVPNNPNPMASILMTTALAMKLGLAPFHFWVPEVTQGIPLSSGMILLTWQKIAPLSVLYQISPTINPNLLLPMATLSVLIGGWGGLNQTQLRKILAYSSIAHMGWMTAILLYNPTMMILNLTIYIIMTLTTFMLFMLNSTTTTLSLSQTWNKMPLITSLITMLMLSLGGLPPLSGFMPKWMIIQELTKNEMIIMPTFLAITALLNLYFYMRLTYATALTMFPSTNNMKMKWQFESTKKMTFLPPLIITSTMLLPLTPMISILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.818 kDa

MNPLAQPIIYSTIFAGTLITALSSHWFFAWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLTQATASMILLMAILSNNMLSGQWTTTNATNQYSSLMIVVAMAMKLGMAPFHFWVPEVTQGTPLMSGLLLLTWQKLAPMSIMYQISSSTNVSLLLTLSILSILAGSWGGLNQTQLRKILAYSSITHVGWMMAVLPYNPNMTILNLTIYIILTTTTFLLLNLSSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWLIIEEFTKNNDLITPTIMAIITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQLEYTKPTPFLPTLITLTTLLLPISPFMLMVL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.767 kDa

MKPPILIIIMSTVMSGTMIVLTSSHWLLIWIGFEMNMLAIIPILMKNHTPRATEASTKYFLTQATASMLLMMGIIINLMFSGEWSISKIPNPIASGLVTIALTMKLGMAPFHFWVPEVTQGISLSSGMILLTWQKIAPLSILYQISPSINPKLLITMAIASVLIGGWGGLNQTQLRKILAYSSIAHMGWMAVILTYNPTLMILNLTIYITMTLSTFMLFMHNSSTTTLSLSNTWNKLPLMTSLILVLMMSLGGLPPLSGFAPKWMIIQELTKNDMIILPTFMAITALLNLYFYMRLSYTTALTMFPSVNNMKMKWQFESAKKIILLPPLIIISTMLLPMTPMMSILE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.973 kDa

MNPFVSVIIYTTIILGTMIVMTSSHWLLTWTGFEMNMLAIIPIMMKSPNPRATEASVKYFMTQATASMLLMLAVIINLLYSGQWTVMKMLNPTASMIMTMALAMKLGLSPFHFWVPEVTQGVPLTAGLILLTWQKLAPLSILYQISPSINPNLILTMSMLSILVGGWGGLNQTQLRKIMAYSSIAHMGWMAAILIYNPTMTILNLTIYLMTTFTMFTMFALNSTTTTLSLSHTWNKTPIITTLMLTILLSMGGLPPLTGFVPKWMIIQEMTKNDSIILPTLMAIMALLNLYFYMRLTYSTTLTMFPSSNNMKMKWQFEASKHKTLLPTMIILSTMLLPLTPMLVVLD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.961 kDa

MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.737 kDa

MNPLAQPIIYSTIFAGTLITASSSHWFLTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLVQATASMILMMAILSNNLLSGQWTMANITNQYSSTMMLMALAMKLGMAPFHFWVPEVTQGTTLMSGLLLLTWQKLAPISIMYQIFPVVNVNILLAFSILSIMVGSWGGLNQTQLRKILAYSSITHVGWMMAVLPYNPDITIFNLIIYIVLTTTAFLALNLNSSTTTLLLSRSWNKLTWLLPLIPSTLLSLGGLPPLTGFLPKWLVIEELTKNGTLIIPTAMAIITLINLYFYMRLIYSTSITLLPTSNNVKMKWQFENTKPTFLLPTLMTLTTLLLPIAPLTFPTP

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.147 kDa

MLSPLIQSTLLMTLGLGTLVTFSSTSWILAWIGLEINTIAIIPLMAKTHHPRSIEATTKYFIAQSAGSATLLVTACLAAWHSGNWAISPSSDPIILNAMTLALMFKLGMAPMHFWLPEVMAGLDLTTGMILATWQKLAPITLLIQIAQDQNNAFILGPALLSVFVGGWGGLNQTQTRKIIAYSSIAHMGWIASMAPFNPTITWVTTLIYCLLTSTTFINLNTLKANKITALTMNKHNQISQMLLLLLLLSLGGLPPLTGFTNKLLASVELANQNLVIYLFMMMMGSLLSLFFYTRMCYLSIILSPPCPTTNLTLWRVTPNKPMALMTMLSINLFILTPQLMAIFIMY

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.079 kDa

MKPIILMFIMLTIFMGTMLTMISSHWLLMWVGLEINMLAIIPILMKKISPRSTEAATKYFLTQATASMLLMFSIVINTANSGQWGITNMHNQLTSLVTMAALMMKLGMTPFHFWVPEVTQGISLMSGMLLLTWQKLAPISILLQIFPSMNPNIILLIAILSILVGGWGGLNQTQLRKILAYSSIAHMGWMMAILMYWPSLTMLNLLIYLMLTITLFSVLNINTNTTTLTLSNTWNKTPMITLTILISLLSLGGLPPLTGFLPKWTIIQELTKNSNIMLATIMAIMALLNLYFYMRLIYSTSLTMFPTLNNMKMKWQFQQTKQIFLLSPLVILATLTLPLSPALLTLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.093 kDa

MNPLALSLILTTLLAGTLITMMSSHWLTAWMGLEMNMLTMIPILMKTTNPRSTEAATKYFMTQAMASMMLMMALTINLMYSGQWSITKMTNPVASNMALMALMTKLGSAPFHFWVPEVTQGVELTPGMILLTWQKLAPLSLLYQMATYTNTNLIYLSGLLSILIGGWGGLNQTQLRKILAYSSISHMGWMLIILPFNPTLTLLNLTIYIMLTLSIFMILTNTFTTSMSSLTLMWNKTPAMTIMLMTTLLSLGGLPPLSGFMPKWLMIHELTKNNSIIMPLTMAIMALLNMYFYMRLIYYSSLTILPSTNNMKMTWRFTNTKHTMTLPTLITLSNMLLPLTPMISMLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.913 kDa

MNPLALSLILTTLLAGTLITMMSSHWLTAWMGLEMNMLTMIPILMKTTNPRSTEAATKYFMTQATASMMLMMALTINLMYSGQWSIMKMTNPVASNVALMALMTKLGSAPFHFWVPEVTQGVELTSGMILLTWQKLAPLSLLYQMATYTNTNLIYLSGLLSILIGGWGGLNQTQLRKILAYSSISHMGWMLIILPFNPTLTLLNLAIYILLTLSIFMILANTLTTSMSSLTLMWNKTPAMTIMLMTTLLSLGGLPPLSGFTPKWLMIHELTKNNSIIMPLTMAIMTLLNMYFYMRLIYYSSLTILPSTNNMKMTWQFTSTKHTMMLPTLITLSNMLLPLTPMISMLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.422 kDa

MKPPIFIIIMTTVISGTMMVLISSHWLLIWIGFEMNMLAIIPILMKKFNPRAMEASTKYFLTQATASMILMLGIIINLLYSGQWTMLHTPNPMASNMMTIALTMKLGLSPFHFWVPEVTQGISLSSGMILLTWQKIAPLSVLYQMAPSINPNLLMSMAIMSMLVAGWGGLNQTQLRKILAYSSIGHMGWMTSITVYNPTLMHLNLVMYIMMTLGTFMLFMYNSSLTTLSLSYSWNKFPLTTLLILMLMLSLGGLPPLSGFIPKWMIIQELTKNNMIIIPTFMAIAALLSLYFYMRLTYTTALTMFPSMNNMKMKWQFENTKKITLLPPLIIMSTMLLPMTPMMLILY

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.755 kDa

MKPAILITITSTVVLGTMIVLFSSHWFMIWVGFEMNMLAIIPILMKKYNPRAMEASTKYFLTQATASMLLMLSIIINLLCSGHWTVSTIPNPVASTMITIALTMKLGLSPFHFWVPEVTQGISLSSGMILLTWQKIAPLSILYQISPSVNSNLLLMMAITSMLVGGWGGLNQTQLRKILAYSSITHMGWMAAIMVYNPTLAILNLTIYIMMTLGTFMLFMHSSSTTTLSLSYTWNKFPLMAPLILMLMLSLGGLPPLSGFIPKWMIIQELTKNDMIIMPTLMAITALLNLYFYTRLTYTTALTMFPATNNMKMKWQFETTKKTTLLAPLIVTSTMLLPLTPMLAALD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.102 kDa

MKPPILIIIMATIMTGTMIVMLSSHWLLIWIGFEMNMLAIIPILMKKYNPRAMEASTKYFLTQATASMLLMMGVTINLLYSGQWVISKISNPIASIMMTTALTMKLGLSPFHFWVPEVTQGITLMSGMILLTWQKIAPMSILYQISPSINTNLLMLMALTSVLVGGWGGLNQTQLRKIMAYSSIAHMGWMAAIITYNPTMMVLNLTLYILMTLSTFMLFMLNSSTTTLSLSHMWNKFPLITSMILILMLSLGGLPPLSGFIPKWMIIQELTKNNMIIIPTLMAITALLNLYFYLRLTYSTALTMFPSTNNMKMKWQFEYTKKATLLPPLIITSTMLLPLTPMLSVLD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.102 kDa

MKPPILIIIMATIMTGTMIVMLSSHWLLIWIGFEMNMLAIIPILMKKYNPRAMEASTKYFLTQATASMLLMMGVTINLLYSGQWVISKISNPIASIMMTTALTMKLGLSPFHFWVPEVTQGVTLMSGMILLTWQKIAPMSILYQISPSINTNLLMLMALTSVLVGGWGGLNQTQLRKIMAYSSIAHMGWMAAIITYNPTMMILNLTLYILMTLSTFMLFMLNSSTTTLSLSHMWNKFPLITSMILILMLSLGGLPPLSGFIPKWMIIQELTKNNMIIIPTLMAITALLNLYFYLRLTYSTALTMFPSTNNMKMKWQFEYTKKATLLPPLIITSTMLLPLTPMLSVLD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.988 kDa

MKPPILIIIMATIMTGTMIVMLSSHWLLIWIGFEMNMLAVIPVLMKKYNPRTMEASTKYFLTQATASMLLMMGVTINLLYSGQWVVSKISNPAASIMMTIALTMKLGLSPFHFWVPEVTQGITLTSGMILLTWQKIAPMSVLYQISPSINTNLLMLVALVSVLVGGWGGLNQTQLRKIMAYSSIAHMGWMAAIIIYNPTMMILNLVLYILMTLSTFMLFMLNSSTTTLSLSHMWNKFPLITSIILILMLSLGGLPPLSGFIPKWMIIQELTKNNMIIIPTLMAITALLNLYFYLRLTYSTALTMFPSANNMKMKWQFEHTKKTILLPPLIITSTMLLPLTPMLSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.136 kDa

MNPIIFIIILMTVMLGTTIVMISSHWLRIWIGFEMNMLAIIPIMMKKHNPRATAASSDYFLTQSTASMLLMMAIIINLMFSGQWTVTKLFHPTASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLVPMSVLYQILPSINLDLILTLSILSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMTAILPYNPTMMLLNLIIYITMTSTMFLLFMANSTTTTLSLSLTWNKMPIMTTLVLITLLSMGGLPPLSGFVPKWMIIQEMTKNNSIILPTLMAITALLNLYFYMRLTYSTTLTMFPSTNNMKMKWQFSTTKRMTLLPTLTVLSTMLLPLTPILSILE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.379 kDa

MNPLALIMITTTIILGTVIVMMSSHWLLVWIGFEMNMLAVIPVLMKRHNPRAVEAATKYFLTQATASMLLMLAVVTNLLYSGQWTVANMTNPLASTVMTLALAMKLGLSPFHFWVPEVTQGVPLLSGLILLTWQKLAPLSVLYQTSPSLNLNLLLAMATVSVAVGGWGGLNQTQLRKILAYSSIAHMGWMTIILTYNPTLTLLNLLLYILMTATTFMLFMSNSSTTTLMLSHSWNKSPVAATSVLIIMLSLGGLPPLSGFLPKWMIIQELTKNESIFLPTLMAMMALLSLYFYMRLTYSTSLTLFPSTNNMKMKWQLEDTKRTPLLSPLIVMSTLALPLAPILSTLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.079 kDa

MNPIVFSTILTTAIMGTMIVMTSSHWLMIWIGFEMNLLAIIPILMKKFNPRAMEAATKYFLTQATASMLLMMAIIINLMFSSQWTITKIFNPTASIIMTSALIMKLGLSPFHFWVPEVTQGIPLVSGLILLTWQKLAPMSVLYQIAPSINLDMLMTSALLSILVGGWGGLNQTQLRKIMAYSSIAHMGWMTAILTYNPTMTALNMLIYIMMTLTTFMLFMLNSSTTTLSLSHTWNKTPLITSLILITMLSLGGLPPLSGFIPKWMIIQELTKNDSIILPTSMAIMALLNLYFYMRLTYSTSLTMFPSTNNMKMKWQFENPKRMNFLPTLIIMSTLLLPLTPIMSTLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.97 kDa

MNPLIMSIIMSTIILGTLIVMTSSHWLMIWIGFEMNMLAIIPMLMKHHNPRSTEAATKYFFTQATASMLLMLAVIINLMYSGQWTGMKLFNPTASIIMTLALTMKLGLAPFHFWVPEVAQGIPLSSGLILLTWQKLAPLTVLYMISPAINLYLLLTMSMASIAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAILIYNPTMTLLNLVIYILMTTTMFMLLMINSSTTTLSLSHMWNKMPLITTITLVTLLSLGGLPPLTGFLPKWMIIQELTKNDSIILPTLMAITALLNLFFYMRITYATSLTMFPTTNNMKIKWQFENTKHLNLLTPMIVLSTLTLPLAPMMTILN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.379 kDa

MNPLTFTMITSTIILGTSIVITSSHWLTVWIGFEMNMLAIIPVLMKTHHPRSTEAATKYFLIQATASMLLMLAVTINLLSSGQWAVSNMIDPLALTIMTLALAMKLGLSPFHFWVPEVTQGVPLLSGLILLTWQKLAPLSILCTLSPNIDPTLILTMSILSVLVGGWGGLNQTQLRKIMAYSSISHMGWMTAILIYNPSLTILNLLLYIMMTSTTFILLIITSSTTTLSLSHTWNKTPLIAIIILTTMLSLGGLPPLTGFMPKWMILQDLTKNENIALSLFMAMAALLNLYFYTRLTYTTSLTMLPTTNNTKIKWHFKTTKQAASLSPLIIISTMILPLTPTMSALW

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.022 kDa

MKPPILIIIMSTVILGTMIVMTSSHWMLTWIGFEMNMLAIIPILMKKFNPRAMEASTKYFLTQATASMLLMMGIIINLLHSGQWTVSNNLNPTSSILMTTALAMKLGLAPFHFWVPEVTQGISLSSGMILLTWQKIAPLSVLYQISPTINPNLLLPMAILSVLIGGWGGLNQTQLRKIMAYSSITHMGWMTAILLYNPTMMFLNLIIYITMTLSTFMLFMINSATTTLSLSQTWNKAPLITSLILTLMLSLGGLPPLSGFIPKWMIIQELTKNEMIILPTFLAITALLNLYFYMRLTYTTALTMFPSTNNMKMKWQFENTKKMIFLPPLIITSTMLLPLTPMISILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.969 kDa

MNPMIFIILLATIMLGSSIVMMSSHWFMTWLGFEMNMMAIVPVLMKKYSPRSMEAATKYFLTQATASMILMLAIIINLMYSGQWTIANMENHTASMLITIALVMKLGLAPFHFWVPEVTQGIPLSSGLILLTWQKIAPLSLLYQIHSSINMELFLTMSLLSIVIGGWGGLNQTQLRKIMAYSSIGHMGWMMAIMNYNPNLSFLNLLVYILMTSSMFALLIFSSTTSTLSLSLAWNKTPIIATMSLIILLSLGGLPPLTGFMPKWMIIQELTKNNSTILPTLMAISALLNLFFYIRLTYSTALTMFPTMNNMKLTWQFQNTNILPMILPLITISTLALPLTPLFLMLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.16 kDa

MNPMIFIILLTTIMLGTFIVTTSSHWFMTWLGFEMNMMAIVPVLMKKYSPRSMEAATKYFLTQATASMILMLAIIINLMYSGQWTITNMENYTASMLITIALTMKLGLAPFHFWVPEVTQGVSLPSGLILLTWQKIAPLSLLYQTYSSVNMNILLLMSLLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMMAIMVYNPNLSLLNLLIYIFMTSSMFMLLIFSSSVSTLSLSLTWNKAPIITIMSLTTLLSLGGLPPLTGFLPKWMIIQELTKNNSVILPTLMAILALLNLFFYMRLTYSTALTMFPTMNNTKFMWQFQNTNILSMMLPLITISTLALPLTPMLILLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.128 kDa

MNPIILIIILMTVMLGTIIVMISTHWLLIWIGFEMNMLAIIPIMMKKHNPRATEASTKYFLTQSTASMLLMMAIIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQILPSINLDLILTLSILSITIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLLYNPTMTLLNLIIYIIMTSTMFTLFMANSTTTTLSLSHTWNKAPIMTILVLITLLSMGGLPPLSGFMPKWMIIQEMTKNDSIILPTLMAITALLNLYFYMRLTYSTALTMFPSTNNMKMKWQFPTTKRMTLLPTMTVLSTMLLPLTPILSILE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.151 kDa

MNPMIFIILLGTIMLGTSIVMTSSHWFLTWLGFEMNMMAVIPVLMKKYSPRSMEAATKYFLTQATASMILMLAIIINLMFSGQWTITNMDNFTASMLLTTALVMKLGLAPFHFWVPEVTQGVSLNSGLILLTWQKIAPLSLLYQIYPSINTNLLLIMSLLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMMAIMIYNPNLSLLNLFIYILMTSSMFMLLIFASTTSMLSLSLTWNKTPIITIMSLMVLLSLGGLPPLTGFMPKWMIIQELTKNNSVILPTLMAILALLNLFFYMRLTYSSALTMFPTMNNTKLTWQYQNTNILPMMMPLITMSTLALPLTPLFILLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.811 kDa

MNPMIFIVLSATIMSGTSIVLISSHWFMTWLGFEMNMMAIIPVLMKNYNPRSMEAATKYFLTQATASMILMLAIIINLMYSGQWSITNMENPLASTLITLALTMKLGLAPFHFWVPEVTQGVSLSSGLILLTWQKLAPLSLLYQIYASLNTNLLMLMSLLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMIAIMTYNPNLSLLNLIIYILMTTSMFLLLLFNSTTSTLSLSLTWNKTPIITTMILITLLSLGGLPPLTGFVPKWMIIQELTKNNSIILPTIMSILALLNLFFYMRLTYSTALTMFPTTNNMKLAWQFQTTKILPMMAPLIATSTLTLPLTPLLTLLS

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.081 kDa

MKPPILFTILLTVISGTMIVLMSSHWLMIWIGFEMNTLAIIPILMKKSNPRAIEASTKYFLTQATASMILMMGITINLMYSGQWTMSKTLCPMASTMMTIALAMKLGLAPFHFWVPEVTQGVHMSSGLILLTWQKIAPLLVLYQISPTIDPNLLLPMAMMSVLIGGWGGLNQTQLRKILAYSSIAHMGWMATITLYNPTMMLLNLTIYIIMTLTTFMLFMHNSTTTTLSLSQTWNKTPLVTSLILMLMLSLGGLPPLSGFIPKWMIIQELTKNEMIIMPTLLAITALLNLYFYMRLTYTTTLTMFPSTNNMKMKWKFDNTKKMILLPPLTVISTMLLPITPLLSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.871 kDa

MNPLILSMIMATIILGTLIVMTSSHWLMVWIGFEMNMLAILPVLMKKYNPRSMEAATKYFLTQATASMLLMLAITINLIYSGQWSTANPLNPTTSIIMTLALAMKLGLSPFHFWVPEVTQGIQLSSGLILLTWQKLAPMSILYQISPAINMDLLLSMSLMSVAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVMTYNPTMALLNLIIYILLTTTTFMTFMLNSTTTTLSLSHTWNKTPLLTTTILILMLSLGGLPPLSGFLPKWMIIQELTKNDSIITPTIMAITALLNLYFYMRLTYSTSLTMFPSVNNMKMKWQFNSMKQTTHLPPLIVLSTLILPMSPMLMLLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.802 kDa

MNPMTSTILLMTIMSGTSIVLMSSHWFMTWLGFEMNMMAIIPILMKNYNPRSMEAATKYFLTQATASMILVLAIIINLMHSGQWTITITENITASTLITIALVMKLGLAPFHFWVPEVTQGVSLSSGLILLTWQKIAPLSLLYQIYPSINTNLLLTMSLLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMIVIMIYNPNLSLLNLFIYIMMTSSMFMLLIANSATSTSSLSQSWNINPTITTMMMATLLSLGGLPPLTGFAPKWMIIQELTKNNSVILPTLMAILALLNLFFYMRLTYSTALTMFPTMNNMKLMWQFQPTSMTPMMTMLISISTLALPLTPLFISLS

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.979 kDa

MNPMILLMLLITILSGTSIVMMSSHWFLTWLGFEMNMMAMIPVLMKKYNPRAMEAATKYFLTQATASMILVLGIIINLIHSGQWTIMAMESYSASTLLTIALVMKLGLAPFHFWVPEVTQGVSLNSGLILLTWQKIAPLSLLYQIYSSVNTNILLVMSLLSIMVGGWGGLNQTQLRKIMAYSSIAHMGWMIMIMIYNPNLSLLNLLIYILMTSSMFMLLMFNSTISTLALSRTWNINPIITTTILIILLSLGGLPPLSGFMPKWMIIQELTKNDSVILPAVMAILALLNLFFYMRLAYSSSLTMFPTTNNTKMVWQFQPMNVSFMMTSLISISIMALPLTPLAMILY

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.897 kDa

MNPMIFTSLLATIMLGTSIVLTSSHWFLTWLGFEMNMMAIIPVLMKKYNPRSMEAATKYFLTQATASMILVLAIIINLMYSGQWTIMIMENPTASMLITIALVMKLGLAPFHFWVPEVTQGVSLSSGLILLTWQKIAPLSLLYQIFPSINTNLLLIMSLLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMIAIMIYNPNLSLLNLLIYIMMTSSMFMLLIINSTTSTSSLSRAWNINPIVVSTMMVILLSLGGLPPLTGFMPKWMIIQELTKNSSVMLPSLMAILALLNLFFYMRLTYSTALTMFPTMNNMKLTWQFQSTNIMPMMMSLISMSMLALPLAPSLITLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.882 kDa

MNPMTFTVLLATIMSGTSIVLLSSHWFMTWLGFEMNMMAIIPVLMKKYNPRSMEAATKYFLTQATASMILVLAIIINTMYSGQWTIMNMENQLASILITLALVMKLGLAPFHFWVPEVTQGVSLDSGLILLTWQKIAPLSLLYQIYPSLNTNLLLTMSLLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMIAIMTYNPNLSLLNLIIYITMTSSMFMLLIINSTTSTLSLSLTWNKTPIVTTMMLISLLSLGGLPPLTGFMPKWMIIQELTKNNSLILPTLMSILALLNLFFYMRLAYSTTLTMFPTTNNTKLSWQFKNTNILPTTAPLISISTMILPLTPLLITLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.669 kDa

MNPLAQPIIYSTIFAGTLITASSSHWFLAWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLVQATASMILMMAILSNNLLSGQWTTTNITNQYSSLMILTALAMKLGMAPFHFWVPEVTQGTTLTSGLLLLTWQKLAPISIMYQIFPVMNVNILLTFSILSIMVGSWGGLNQTQLRKILAYSSITHVGWMTAVLPYNPNITIFNLTIYIVLTTTAFLALNLNSSTTTLLLSRSWNKLTWLLPLIPSTLLSLGGLPPLTGFLPKWLVIEELTKNGTLIIPTIMAIVTLINLYFYMRLIYSTSITLFPTSNNVKMKWQFENMKPTLLLPTLTILTTLLLPIAPLTFPAP

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.644 kDa

MNPLIFSIITFTMMLGTGIVMTSSHWLTMWIGFEMNMLAIIPILMKKYNPRSMEASTKYFLTQATASMLLMLAVTINLVHSGQWSTTNPLNPAASIILTLAMAMKLGLSPFHFWVPEVTQGVHLPSGLILLTWQKLAPMSVLYQISPMINLDLMFTMSILSIAIGGWGGLNQTQLRKVMAYSSIAHMGWMTAILAYNPTMALLNLTIYIILTTTTFLTFMTNSTTTTLSLSHLWNKEPLITTIILVTMLSLGGLPPLSGFLPKWMIIQELTKNNSIIAPTTMAITALLNLFFYMRLIYSSALTLFPSMNNTVMKWQLNQTKSTALLSPLTILSTMILPLSPMLMLLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.743 kDa

MKPPILTIIMSTVISGTIMVLISSHWLTVWIGFEMNMLAIVPILMKKFNPRAMEASTKYFLTQATASMLLMLGIIINLLLTGQWTVLNMPNPIASNTMTVALAMKLGLSPFHFWVPEVTQGVPLSSGMILLTWQKIAPLSILYQISPSTNPNLLMTMAALSVLVGGWGGLNQTQLRKILAYSSIAHMGWMIAVTTYNPTLMMLNLAIYIMMTLGTFMLFMLNSSTTTLSLSHVWNKLPLTTSLILMIMLSLGGLPPLSGFIPKWMIIHELTKNNMIIMATFMAITALLNLYFYMRLTYATALTMFPSTNIMKMKWQFENTKNTTLLPPLIVISTMLLPLTPMMLSLF

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.681 kDa

MNPPILAIVMSTVISGTIMVLISSHWLTIWIGFEMNMLAIIPILMKKFNPRAMEASTKYFLTQATASMLLMLGIIINLLLTGQWTVLNMPNPVASNMMTAALAMKLGLSPFHFWVPEVTQGVPMSSGMILLTWQKIAPLSILYQIAPSMNPNLLMAMAIMSVLVGGWGGLNQTQLRKILAYSSIAHMGWMIAVTTYNPTLMLLNLTIYITMTLGTFMLFMLNSSTTTLSLSHTWNKLPLIASLILMTMLSLGGLPPLSGFIPKWMIIHELTKNDMAIMATFMAMTALLNLYFYMRLTYATALTMFPSTNIMKMKWQFESTKNTTLLPPLIMISTMLLPLTPMVLTLF

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.364 kDa

MNPLASIMITLTIILGTMIVMTSSHWLLVWIGFEMNMLAIIPVLMKQHSPRAVEAATKYFLTQATASMLLMLAVVTNLLYSGQWTVTNITNPLASAVMTLALVMKLGLSPFHFWVPEVAQGIPLSSGLVLLTWQKLAPLSVLYQISHSVSPTLLLTVSLMSIAVGGWGGLNQTQLRKILAYSSIAHMGWMTAVLAYNPTLTLLNLTLYILMTTTTFLLFMFNSSTTTLTLSHSWNKSPMIATSTLTIMLSLGGLPPLTGFLPKWMIIQELTKNESLLLPTLMAMMALLSLYFYMRLTYSTSLTLFPSMNNTKMKWHLNNTKKVPLLPPMITLFTLALPLAPALSTLY

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.669 kDa

MSPYVLTIMSLSLLLGTTMTLISDHWLTAWMGLEINTLAVIPLMTKPHHSRSTESAIKYFMIQATASMIILFSAIFNASTTNQWITGQISNTSASFMMTIALAMKLGLAPFHFWVPEVTQGIPLLSGMILLTWQKIAPISIFYQISPSLNMSLLMILSITSTLLGGWGGLNQTQLRKILAYSSIAHMGWMTIIIMIYPSLTILNLILYLASTITMFMVLNQSSSTKINSLSILWNKSAPNMIIITLTLLSLGGLPPLTGFMPKWLILQELINFNNIPLAMMLALSTLLNLFFYMRIIYSSTLTMFPSINNTKLQWALYSHKTILPIPTLTIISSLLLPMTPMFITLS

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.055 kDa

MNPLIMTTILTTVILGTLIVMMSSHWLLIWIGFEMNMLAIIPMLMKQHNPRSTEAATKYFFTQATASMLLMLAVLLNLMYSGQWTVMKLYNPTASMIMTMALTMKLGLAPFHFWVPEVTQGIPLSSGLILLTWQKLAPLTVLYTISPNINLTMLLTMSIASIAIGGWGGLNQTQLRKIMAYSSIAHMGWMTTILIYNPTMTLLNLVIYILMTTTMFMLFMTSSSTTTLSLSHMWNKTPMIVTITLATLLSLGGLPPLTGFMPKWMIIQELTKNNNIILPTIMAITALLNLFFYMRLTYATSLTMFPTTNNMKIKWQFENPKRLSLLTPMIVLSTLTLPPTPMIIILN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.888 kDa

MNPLIMSIILATIILGTTIVMTGSHWLMIWIGFEMNMLAIIPMLMKQHNPRSTEAATKYFFTQATASMLLMLAGIINLMYSGQWTGVKLVNPTASIIMTLALAMKLGLAPFHFWVPEVTQGIPLSSGLILLTWQKLASMTGLYMISPGINLNMLMTMSMLSIAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAILIYNPTMTLLNLVIYILMTTTMFMLFMINSSTTTLSLSHTWNKMPLITTTTLVTLLSMGGLPPLMGFLPKWMIIQEMTKNNNIVLPTIMAITALLNLFFYMRLTYATSLTMFPTTNNMKIKWQFENPKYLSLLTPMIMMSTLTLPLAPMMMILN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.74 kDa

MKPPILLIILLTMISGTMIVLTSSHWLTIWIGLEMNMLAIIPILMKKSNPRAIEASTKYLLTQATASMILMMGITINLMFSGQWATSKTLCPTTSAMVTTALAMKLGLAPFHFWVPEVTQGTHLSSGLILLTWQKIAPLSVLYQTSPTIDPNLLLPMAITSILIGGWGGLNQTQLRKILAYSSIAHMGWMTAVTLYNPTMMLLNLTIYIIMTTTTFMLFMYNSTTTTLSLSQTWNKAPLITPLILMLMLSLGGLPPLSGFIPKWMIIQELTKNEMIIIPTIMAITALLNLYFYMRLTYSTTLTMFPSTNNMKMKWKFDNMKKMILLSPLTVVSTMLLPITPLLSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.989 kDa

MKPPILIIIMFTVISGTIMVLMSSHWLMIWIGFEMNMLAIIPILMKKYNPRAVEAATKYFLTQATASMLLMLGIIMNLLLTGQWAVLSTLNPIVSNTMTVALAMKLGLSPFHFWVPEVTQGIPLLSGMVLLTWQKIAPLSILYQMAPSMNPHLLMTMALMSVLVGGWGGLNQTQLRKILAYSSIAHMGWMIAVMTYSPTLMLLNLSIYITMTLGTFMLFMFNSSTTTLSLSLTWNKLPLITSLILIIMLSLGGLPPLSGFIPKWMIIHELTKNNMIITTMLMTITALLNLYFYMRLTYATALTMFPSTNNMKMKWQFESTKNMTMLPPLIVISTMLLPLTPMMSTLF

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.293 kDa

MNPLIFIMLILTIILGTSIILTSTHWFMIWLGFEMNMMAMIPVLMKKYSPRAAEAATKYFLTQATASMILMLALIINLMYSGQWTIMNMTNNMASLLITIALTMKLGLAPFHFWVPEVTQGVSLQAGLILLTWQKIAPLAVMYQIFASINPNLLLTMALLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMTAIMIYNPNLMLLNLLLYILMTTSMFMMFMYNSTTTTLSLSLTWNKTPLMTVLMMTTLLSLGGLPPLTGFMPKWMIIHELTKNNSVILPTSMAILALINLFFYMRLTYSTSLTMFPTINNMKMKWQFQNTHHTTLLAPLITLSTLILPLTPMFILMT

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.96 kDa

MNPLTLSLVLTTMMAGTLIVMTSSHWFMIWVGFEMNMLAIIPLLTKEHNPRSTEAATKYFLTQATASMLLMMAAITNLLYTGHWSIMKLINPTASIMMTMALTMKLGLSPFHFWVPEVTQGIPLMSGLILLTWQKLAPLSGLYMIMPLINTDILLIMSLMSIAIGGWGGLNQTQLRKIMAYSSIAHMGWMMAVLAYNPTMTLLNLYIYIPMTITTFMLLMINSTTTTTSLSQTWNKLPLITTLILITMLSLGGLPPLTGFLPKWAIIQEMTKNSSIIMPTLMTLLALLNLYFYTRITYTTSLTMFPTANNMKIKWQFKNPKQMMSLPLMIMISTLVPPLAPMMPILT

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.065 kDa

MKPPILIIILSTVISGTMIVLTSSHWLLTWIGFEMNMLAIIPILMKKFNPRAMEASTKYFLTQATASMLLMMGIIINLLYSGQWTVSKNLHPMASTMMTIAMTMKLGLAPFHFWVPEVTQGIPLSSGMILLTWQKIAPLSVLYQISPSINTNLLMTMATMSVLIGGWGGLNQTQLRKILAYSSIAHMGWMVAIMTYNPTVMILNLMMYIMMTLTSFMLFIHTSATTTLSLSHTWNKTPLITSFILVLMLSLGGLPPLSGFIPKWMIIQELTKNEMIILPTLLAITALLNLYFYMRLTYATALTMFPSTNNMKMKWQFERTKKMALLPPLIIISTMLLPLTPMMSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.24 kDa

MKPPILIIIMFTMISGTMMVLMSSHWLTTWIGFEMNMLAMVPILMKKFNPRTVEASTKYFLTQATASMIMMLSITVNLLLTGQWTVLNMNNQITSNMMTIALAMKLGLSPFHFWVPEVTQGVSLTSGVILLTWQKIAPLSVLYQISPSINSDLLTTMAMMSILIGAWGGLNQTQLRKILAYSSISHMGWMITMTTYNPTLMMLNLMIYILMTFVTFTLFAYSKSTTTLSLSHTWNKSPLIASLIMALMLSLGGLPPLSGFIPKWMIIQELTKNDMIIMPTLMAMMALLNLYFYMRLMYSTALTMFPSTNNIKMKWQFENSKKPILLPPLIVTSTMLLPLTPMMAILY

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.829 kDa

MNPLIFSTILATIIMGTAIVMTSSHWLTIWIGFEMNMLAIIPMLMKQHNPRSTEAATKYFLTQATASMLLMLAVIMNLTHTGQWTITKSFNPLASIIMTIALTMKLGLSPFHFWVPEVAQGIPLSSCLILLTWQKLAPLSILYMISPTINLNLLLSMSLISVAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAILAYNPTMTMLNLLVYITMTTTMFMLLIKSASTTTLSLAIMWNKVPLVTTLTLTIMLSLGGLPPLTGFLPKWMIIQELTKNNNIIMPTLMAIMALLSLYFYMRLTYATTLTMFPTTNNMKMKWQFEPKKHMNLLSPLIVMSTLTLPLAPMMSLLD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.766 kDa

MNPLIFSTILATIIMGTVIVMTSSHWLTIWIGFEMNMLAIIPMLMKQHNPRSTEAATKYFLTQATASMLLMLAVIINLTHTGQWTITKSFNPLASIIMTIALTMKLGLSPFHFWVPEVAQGIPLSSCLILLTWQKLAPLSILYMISPTINLNLLLSMSLISIAIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLAYNPTMTMLNLLVYITMTTTMFMLLIKSASTTTLSLAIMWNKIPLVTTLTLTIMLSLGGLPPLTGFLPKWMIIQELTKNNNIILPTLMAIMALLSLYFYMRLTYATTLTMFPTTNDLKIKWQFEPKKHMNLLSPLIVTSTLTLPLAPTMLLLD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.806 kDa

MNPLIFTMILLTVMLGTAIVMTTSHWVMAWIGFEMNMLAIIPILMKKYNPRSMEASTKYFLTQATASMLLMLAIVINLTYSGQWSMTKPLNSTASIIMTLAMAMKLGLAPFHFWVPEVTQGVQLSSGLILLTWQKLAPMSILYQISPTINLDLLLLMSILSILVGGWGGLNQTQLRKILAYSSIAHMGWMTAIMVYNPTMALLNLAIYILLTTTTFVMLMVDSSTTTLSLSHMWNKMPLLTTAILTIMLSLGGLPPLSGFTPKWMIIQEMTKNDSMITPTIMAVMTLLNLYFYMRLTYSTSLTMFPSTNNMKVKWQFNNKKLTANLSPLIILSTLILPLSPMLALLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.871 kDa

MNPLIFTMILLTVMLGTAIVMTTSHWVMAWIGFEMNMLAVIPILMKKYNPRSMEASTKYFLTQATASMLLMLAIVINLVYSGQWSMTKPLTSTTSIIMTLALAMKLGLAPFHFWVPEVTQGVQLSSGLILLTWQKLAPMSILYQISPTINLDLLLLMSLLSILVGGWGGLNQTQLRKIMAYSSIAHMGWMTAIMVYNPTMALLNLVIYILLTTTTFMMLMMNSSTTTLSLSHMWNKTPLLTTAILTIMLSLGGLPPLSGFTPKWMIIQELTKNDNMIMPTIMAVMALLNLYFYMRLTYSTSLTMFPSTNNMKIKWQFSHKKPTANLSPLIILSTLILPLSPMLALLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.215 kDa

MNPMTFSLIMMTMVSGTFLVMMSSHWFLIWVGFEMNMLAIIPLLTKQHNPRSTEAATKYFLTQATASMLLMMAAIINLLYSGHWSVQKLINPMASVTMTMALAMKLGLAPFHFWVPEVTQGIPLSSGLILLTWQKLAPLSIMYMISPLTNLNILMIMALLSIAIGGWGGLNQTQLRKIMAYSSIAHMGWMMSVLMYNPNMMLLNLYLYIPMTITTFSLLMINSTTTTTSLSYTWNKLPLITMIILITMLSLGGLPPLTGFLPKWLIIQELVKNNNIILSTVMALLALLNLYFYTRITYTTSLTLFPTMNNTKITWQFKYPKQMLYLPLMIIISTLILPVSPMTAILE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.823 kDa

MTPMTTLIMLFSLLLGTTLTLTSSHWLLMWMGLEVSTLAIIPLLTYTNHPRSIESAIKYFLTQATASMLLMFAASLNTWMTGHWTLMQIDNTISSGIMTFALAMKLGLAPFHYWVPEVLQGSSLMSGMILLTWQKLAPISIIYQISPTLNMDILLTLAISSTLLGGWNGLNQTQLRKVMAYSSIAHMGWMVLIIIYFPTLTTLNLTLYIMSTVALFTVFHTTNITKTKPLSLMWNKAPIMTLAIILLLLSLGGLPPLTGFAPKWLVIQELIKHDNMIMATVLAITALLNLFFYMRIIYSSTLTTFPTTNNNKFHWYSKSTKNPLSLPTLVILSTTLLPLTPMFITLS

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.17 kDa

MNPLVTLIIYITLISGTIITMTSSHWLTVWMGLEMNMFAIIPLIMKTHTPRAIEATTKYFLIQASASMLLLMAATINFMEFGQWTVIDMPSPIASTIILAAIMMKLGMAPFHFWVPEVTQGTLLSTSLIILTWQKLAPLSILYQIYPSMNPKIILASAMLSIMIGGWGGLNQTQLRKIMAYSSIAHMGWMSAILIYNPSLMLLNLTLYIIFTITMFTILIHCMATSNKTLSMMWNNTPILMMTLLLTLLSMGGLPPLSGFVPKWLIINEMITNNNITISLTMAMLALLNLYFYMRLIYSSSLTLFPSSNNMKFKWKMNNTPKLPFLPTLTIISILMLPITPMMFIFE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.073 kDa

MNPLAQPIIYSTIFAGTFITVLSSHWFFTWVGLEMNMLAFIPVLTKKMSPRSTEAAIKYFLTQATASMILLMAILSNNMLSGQWTMTNTTNQYSSLMIMTAMAMKLGMAPFHFWVPEVTQGTPLMSGLLLLTWQKLAPISIMYQMSSSLNVNLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTTFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWVIIEEFTKNNSLIIPTTMAIITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLITLTTLLLPISPFMLMIL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.02 kDa

MNPLAQPIIYSTIFTGTLITALSSHWFFTWVGLEMNMLAFIPILTKKMSPRSTEAATKYFLTQATASMILLMAILSNSMLSGQWTMTNTTNQYPSLMIMMAMAMKLGMAPFHFWVPEVTQGTPLMSGLLLLTWQKLAPISIMYQISSSLNVNLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWVIIEEFTKNNSLIIPTIMAIITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLITLTTLLLPISPFMLMIL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.143 kDa

MKPPILIIIMSTVISGTMIVLTSSHWMLTWIGFEMNMLAVIPILMKKFNPRAMEASTKYFLMQATASMLLMMGITINLLHTGQWTILNNLNPTASTLMTIALAMKLGLAPFHFWVPEVTQGISLSSGMILLTWQKIAPLSVLYQISPNINPKLLLLMAILSVLIGGWGGLNQTQLRKILAYSSIAHMGWMSTILIYNPTMMLLNLIIYIMMTLSTFMLFMHNSTTTTLALSQTWNKMPLITSLILMLMLSLGGLPPLSGFIPKWMIIQELTKNEMIIMPTFLAITALLNLYFYMRLTYATALTMFPSTNNMKMKWQFENTKKTMFLPPLIVMSTMLIPLTPIISILE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.841 kDa

MNPVVLTMILLTIMLGTVIVMTTSHWLLVWIGFEMNMLAIIPILMKKYNPRSMEASTKYFLTQATASMLLMLAIVINLIHSGQWSTTNPLDPTTSIIMTLALAMKLGLAPFHFWVPEVTQGIQLSSGLILLTWQKLAPMSILYQISPTINLHLLLLMSLTSILIGGWGGLNQTQLRKIMAYSSIAHMGWMTTIMIYNPTMALLNLTIYIILTTTTFMTFMMSSSTTTLSLSHLWNKMPLLTSAVLMTMLSLGGLPPLSGFSPKWMIIQELTKNNSIIMPTIMAITALLNLFFYMRLAYSTSLTMFPSTNNMKIKWQFNNSKSMNLLSPMIILSTLILPLSPMLALLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

347 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.971 kDa

MNPLILLLITLTVILGTLIVMMSSHWLMIWMGFEMNMLAVIPLLMKQYNPRSMEAATKYFLTQATASMLLMLAIIINLMYSGQWTFTKFMDPTASIIMTLALMMKLGLAPFHFWVPEVTQGISLTSGLILLTWQKLAPLSILYTITPVINPDLLLMASMLSIAIGGWGGLNQTQLRKILAYSSIAHMGWMMSVLAFNPTMTLLNLFMYILMTSTTFMLFMVASTTTTLSLSLTWNKTPLITTSILIMMLSLGGLPPLAGFLPKWMIIQELTKSNNIILATLMAITALLNLFFYIRLTYATSLTMFPTTNNMKIKWQFKTTKQMNYLPPLIIMSTLTLPLAPAMILLN

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.871 kDa

MNPLILTIILMTVFLGTMIVMASSHWLMIWIGFEMNLLAIIPILMKKYNPRAMEASTKYFLTQATASMLLMMAIIINLMHSGQWTITKVFNPTASIIMTLALAMKLGLTPFHFWVPEVTQGISLTSGLILLTWQKLAPMSILYQISPSINLNILLTMAVLSILVGGWGGLNQTQLRKIMAYSSIAHMGWMAAILVYNPTLTMLNMLIYIMMTLTMFMLFIHSSSTTTLSLSHTWNKAPLITTLILITLLSMGGLPPLSGFMPKWMIIQELTKNSSIILPTLMAIMALLNLYFYMRLTYSTSLTMFPSTNNMKMKWQFETKQITLLPPLIIASSLLLPLTPMLSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.681 kDa

MNPHATPVLVLSLALGTTITISSNHWVLAWTGLEINTLAIIPLISKSHHPRAVEAATKYFLTQAAASALVLFSSMTNAWATGQWDITQLNHPTSCLLLTAAIAIKLGLVPFHFWFPEVLQGSPLMTALLLSTLMKFPPLTLLLMTSKSLNPALLTAMALASAALGGWMGLNQTQTRKILAFSSISHLGWIAIILVYSPKLALLTFYLYTIMTSAVFMALNKIKALNLSMVLTSWTKTPVLNATLMLVLLSLAGLPPLTGFMPKWLIIQELTKQEMTPAAMAIAMLSLLSLFFYLRLAYHSTITLPPNSSNHMKQWYTSKPPSTPTAILASLSILLLPLSPMIHAIV

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.772 kDa

MNPRATPVLVLSLALGTTITISSNHWVLAWTGLEINTLAIIPLISKSHHPRAVEAATKYFLTQAAASALVLFSSMTNAWATGQWDITQLNHPTSCLLLTAAIAIKLGLVPFHFWFPEVLQGSPLMTALLLSTLMKFPPLTLLLMTSKSLNPALLTAMALASTALGGWMGLNQTQTRKILAFSSISHLGWIAIILVYSPKLALLTFYLYTIMTSAVFMALNKIKALNLSMILISWTKTPVLNTTLMLVLLSLAGLPPLTGFMPKWLIIQELTKQEMTPAAMAIAMLSLLSLFFYLRLAYHSTITLPPNSSNHMKQWYTSKPPSTPTAILASLSILLLPLSPMVHAIV

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.134 kDa

MNPIIFTTILLTIMLGTNNVMISSHWLLVWIGFEMNMLAIIPIMMKNHNPRATEASTKYFLTQSTASMLLMMAVIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQIFPSINLNLILTLSILSILIGGWGGLNQTQLRKIMAYSSIAHMGWMTASLHTPYYTLLNLIIYITMTSTMFTMFMANSTTTTLSLSHTWNKTPIMTILILATLLSMGGLPPLSGFMPKWMIIQEMTKNNSIILPTFMAITALLNLYFYMRLTYSTALTMFPSTNNMKMKWQFPLMKKMTFLPTMVVLSTMTLPLTPMLSVLE

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

39.061 kDa

MNPLIFTTILMTVLLGTMIVMMSSHWLMIWIGFEMNLLAIIPILMKKYNPRTMEASTKYFLTQATASMLLMMAIIINLMHSGQWTITKVFNPTASIIMTSALAMKLGLTPFHFWVPEVTQGISLTSGLILLTWQKLAPMSILYQISPSINLNILLTMAVLSILVGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLVYNPTLTMLNMLIYIMMTLTMFMLFIHSSSTTTLSLSHTWNKMPLTTTLILITLLSMGGLPPLSGFMPKWMIIQELTKNSSIILPTLMAIMALLNLYFYMRLTYSTSLTMFPSTNNMKMKWQFETKRITLLPPLIVMSSLLLPLTPMLSILD

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.333 kDa

MNPHAKLICTVSLIMGTSITISSNHWILAWTGLEINTLAIIPLISKSHHPRAIEATIKYFLTQSTASALILFSSMTNAWSTGQWDITQLNHPTSCLMLTMAIAIKLGLVPFHFWFPEVLQGSSLITALLLSTLMKLPPITLLLLTSQSLNTTLLTLLAISSTLIGGWMGLNQTQTRKILAFSSISHLGWMIMIISYNPQLTILTFILYTIMTSTVFLSLAQIKVLKLSTLLISWTKTPMLNATVMLTLLSLAGLPPLTGFMPKWLIIQELTKQEMTPMATIITMLSLLSLFFYLRLAYHSTITLPPNSSNHMKLWRTNKTLNTPTAILTALSTTLLPLSPLIITML

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.087 kDa

MNPHAKLISIMSLALGTSITISSNHWILAWTGLEINTLAIIPLISKSHHPRAIEAAIKYFLTQSTASALILFSSMNNAWSTGQWDITQLNHPTSCLILTMAIAIKLGLVPFHFWFPEVLQGSSLITALLLSTLMKLPPMTLLLMTSQSLNPALLTLLAVSSALVGGWMGLNQTQTRKILAFSSISHLGWMIVIIIYNPKLTILTFIIYSLMTSTVFLSLSQIKVLKLSTMLISWTKTPMLNSTIMVTLLSLAGLPPLTGFMPKWLIIQELTKQEMTPVATTIAMLSLLGLFFYLRLAYHSTITLPPNSSNHMKLWRINTTPNTPTAILTVLSISLLPLSPLITTLV

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.752 kDa

MNPHATPVLVLSLALGTTITISSNHWVLAWTGLEINTLAIIPLISKSHHPRAVEAATKYFLTQAAASALVLFSSMTNAWATGQWDITQLNHPTSCLLLTAAIAIKLGLVPFHFWFPEVLQGSPLMTALLLSTLMKFPPLTLLLMTSKSLNPALLTTMALASAALGGWMGLNQTQTRKILAFSSISHLGWIAIILVYNPKLALLTFYLYTIMTSAVFMALNKIKALNLSMILTSWTKTPVLNATLMLVLLSLAGLPPLTGFMPKWLIIQELTKQEMTPAAMAIAMLSLLSLFFYLRLAYHSTITLPPNSSNHMKQWYTSKPPSTPTAILASLSILLLPLSPMIHAIV

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.737 kDa

MNPHAKLISLISLLLGTTITISSNHWIMAWTGLEINTLAIIPLISKSHHPRAVEASVKYFLVQAAASALVLFSSMSNAWATGQWDITQLTHPTASMLLTAAIAIKLGLVPFHFWFPEVLQGTSLTTALLLSTLMKLPPMAILLMTSPSLNPTVLTSMALASAALGGWMGLNQTQTRKILAFSSIAHLGWMTMIIIYNPKLTLLTFYLYILMTATVFLSLNTTKTLKLSTLMTSWTKAPVLNAALMLTLLSLAGLPPLTGFMPKWLILQELTKQEMTTVATIIALLSLLGLFFYLRLAYYATITLPPNSANHMKQWYISNPTNTSIAILSSLSAILLPISPMILAAL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.711 kDa

MNPHATPVLVLSLALGTTITISSNHWVLAWTGLEINTLAIIPLISKSHHPRAVEAATKYFLTQAAASALVLFSSMTNAWATGQWDITQLNHPTSCLLLTAAIAIKLGLVPFHFWFPEVLQGSPLMTALLLSTLMKFPPLTLLLMTSKSLNPALLTTMALASAALGGWMGLNQTQTRKILAFSSISHLGWIAIILVYSPKLALLTFYLYTIMTSAVFMALNKIKALNLSMVLTSWTKTPVLNATLMLVLLSLAGLPPLTGFMPKWLIIQELTKQEMTPAAMAIAMLSLLSLFFYLRLAYHSTITLPPNSSNHMKQWYTSKPPSTPTAILASLSILLLPLSPMIHAIV

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.681 kDa

MNPHATPVLVLSLALGTTITISSNHWVLAWTGLEINTLAIIPLISKSHHPRAVEAATKYFLTQAAASALVLFSSMTNAWATGQWDITQLNHPTSCLLLTAAIAIKLGLVPFHFWFPEVLQGSPLMTALLLSTLMKFPPLTLLLMTSKSLNPALLTTMALASAALGGWMGLNQTQTRKILAFSSISHLGWIAIILVYSPKLALLTFYLYAIMTSAVFMALNKIKALNLSMVLTSWTKTPVLNATLMLVLLSLAGLPPLTGFMPKWLIIQELTKQEMTPAAMAIAMLSLLSLFFYLRLAYHSTITLPPNSSNHMKQWYTSKPPSTPTAILASLSILLLPLSPMIHAIV

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.747 kDa

MNPHATPVLVLSLALGTTITISSNHWVLAWTGLEINTLAIIPLISKSHHPRAVEAATKYFLTQAAASALVLFSSMTNAWATGQWDITQLNHPTSCLLLTAAIAIKLGLVPFHFWFPEVLQGSPLMTALLLSTLMKFPPLTLLLMTSKSLNPALLTTMALASAALGGWMGLNQTQTRKILAFSSISHLGWIAIILVYSPKLALLTFYLYTIMTSAVFMALNKIKALNMSMVLTSWTKTPVLNATLMLMLLSLAGLPPLTGFMPKWLIIQELTKQEMTPAAMAIAMLSLLSLFFYLRLAYHSTITLPPNSSNHMKQWYTSKPPSTPTAILASLSILLLPLSPMVHAIV

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

346 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.815 kDa

MNPYVRAIITSGLILGPIITMSSNHWITAWCGLEMNSLTMIPLIANKYQPRAIEASTKYFLTQAMASYLMLSAALMNMWYYGQWDMQLLTDNISCTTMTVAMSIKLAAAPFHFWFPEVLQGATVLTALLLTTWQKLAPLTILVQCSQNLDTTLLIALGMTSILIGGWGGLNQTQIRKIMAFSSIAHLGWMYAILTLSPKILLLTFYLYVAMTATTFLMINVLQTNNMSAIMISWTKTPFMNTMMLLNLMSLAGLPPLTGFAPKWLILQEFTKQRLSMFASMMITSSLLSLYFYLRMSYYTIITLPPTTCNYPLQWRLMTNIHTALATITPLATALMPLLPTLKAIP

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

345 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.192 kDa

MNPYILSIMLISLGLGTTLTFASSNWLLAWMGLEINTLAIIPLMANNHHPRAVEAATKYFITQAAAAALLLFSSLINAWQSGQWMIQDMSMPMSALMTIAIAIKLGVAPVHFWLPEVMQGIKLNTGLILATWQKLAPLALLYQISNNLMPELMIALGLMSTIVGGWGGLNQTQIRKIMAYSSIAHLGWIISIMHFMPSLAIINLIMYIIMTTTMFMIFNTLNSTTINALAINWSKFPALSAITMLALLSLGGLPPLSGFLPKWLILQELTNQNLALTATVMALSALLSLYFYLRLSYSLTTTIMPNTYQHMLNWNIKTKITFILPTMMIMTIAMLPISPSIISMF

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

345 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.015 kDa

MNPIINFILLFSMMAGTILAMTSHHWVYAWLGLELNTLAIIPIISKTHHPRATEASTKYFLIQAISSALFLLSGITNAYLYGTWDINHLSNNFSKILLTIALATKLGLAPVHFWLPEVLQGVPILTALIIATWQKVAPMALLIMTWNLIPTPITLTMGLLSTIIGGLGGLNQTPLRKMMAYSSIAHLGWMVIIITIAPNLTLLNLTLYMIFTSSAMLTMHLTISKTLQNAMHISHHSPIITSLFLLSLLSLGGLPPMSGFSPKWLILQELTLHHLTPLALSMALMALLSLMFYLRATYISTMTLSPSIITLKTTWRLKSVSTTSSLSMLTPPSLLILPIMPLLIQ

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

345 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.899 kDa

MNPIINFILLSSMIAGTVLTMTSHHWVSAWLGLELNTLAIIPIISKTHHPRATEASTKYFLIQAASSALMLFAGIINAHLYGTWDITQISNNPTKILLTAALATKLGLAPIHFWLPEILQGVPMLTALIITTWQKIAPMALLITTWNTIPTPMTLTMGFLSVIIGGLGGLNQTQLRKMMAFSSIAHLGWMIVIITITPSLTLFNLVLYITFTSSTMLIMHLTMSKTLQNAMLMSSHSSTTANLFLLSLLSLGGLPPLSGFSPKWLILQELITHNLVPLATTMAITTLFSLMFYLRTTYISAMTLPPSTTPIKNIWRLKPNSSTTMLSMFSLATLFLLPITPTMTQ

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

345 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.859 kDa

MNPLINFILLSSMIAGTILTTTSHHWVSAWLGLELNTLAIIPIISMTHHPRATEASTKYFLIQAASSALVLLSGIINAHLHGSWDISQLSDNFSKIALTTALATKLGLAPIHFWLPEILQGVPILTALIIATWQKIAPMALLIMIWDLIPTPITLIMGLTSTIVGGLGGLNQTQLRKTMAFSSIAHLGWMITMMTIAPNLTLLNLILYIPMTSLTMLIMHLTMSKTLQNAMLIPSHSLTATSLFLLSLLSLGGLPPLSGFIPKWLILQELTIHNLTPMAFMMAITALLSLMFYLRITYISTMTLPPSTTPLKNTWRFKSHQNTSTLPLLSLISIFLLPITPTLTQ

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

345 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.813 kDa

MNPIINLILLSSMIAGTILTMSSHHWVSAWLGLELNTLAIIPIISKTHHPRATEASTKYFLIQAASSALFLLSGITNAYSHGTWDMAHLTNTPSKIMLSVALATKLGLAPIHFWLPEVLQGTPMITALIITTWQKIAPMALLITTWNLIPPTITLIMGLLSTIIGGLGGLNQTQLRKMMAYSSIAHLGWMITITTITPSLALFNLTLYILLTTSTMLIMHLTLSKTLQNTMLIYSYSPTTASLFLLSLLSLGGLPPLSGFSPKWLILQELTTHHLTPLALLMAITALLSLMFYLRTSYISTMTIPPSTTPLKNTWRLKSNSNTSLLSSLILLSLFLLPITPLMIQ

mt-nd2

NADH-ubiquinone oxidoreductase chain 2

345 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.672 kDa

MNPITFSVVLTSLASEQFLAVSSSHWLLAWMGLEINTLAIIPLMTQHKHPRAIEASTKYFLTQAAASALLLFSSLNNAWLTGEWSILDLTNPLSCATMTIAICMKLGLAPFHFWLPEVLQGLSLTTGLILSTWQKLAPMAILYQIAPMLNTPLLLTLGLTSTLIGGWGGLNQTQLRKILAFSSIAHLGWMISILPFSPQLMILNLTIYLIMTSTMFLVLKTISSTKISSLATSWSKTPSTTALSLLTLLSLGGLPPLSGFVPKWFIIQELTSQNTTILATTLALSALLSLFFYLRLTYIVTLTSSPNTSNASLTWRHHSKQPTLLLSIALILSSFIIPISPLTLT

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

344 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

37.625 kDa

MNPLALTIFLLSLAIGTTITLSSFHWLLAWIGLEINTLAIIPLMTKTPHPRAIEAATKYFLTQAAASALVLFSSLISAWQTGEWSINSLMDLPMNILSIALMMKLGLAPLHFWIPEVLQGISLPTGLILSTWQKIAPMALLLQTSHLINLNLTIALGLTSIMVGGWGGIGQTQLRKIMAFSSIGHLGWIIVILKFDPQLSLLNFVLYIIMTAAMFMSLTTISATKMLEISTSWSKTPALTTTTMLILLSLAGLPPLTGFTPKLLITLELVKQNATLLAVMVMFISLLALFFYIRLTYVVTLTLSPNTPNSLLTWRTASRSYSTTAIMNTMALILLPITPTLLLL

MT-ND2

NADH-ubiquinone oxidoreductase chain 2

343 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 2 family.

38.026 kDa

MNPMSWLIITTSIALSTTMITSTTHWLMTWACLEINTLSMVPLISKPNHPRATEAATKYYLIQTMASTSMLFAATTNALNTSNWETHLTTEPMATTIITLALMMKMAAAPFHSWLPSVSQGTTTLTTLTILTWQKIAPLTILLTTHNKTNITLILLSAMLSITMGGLGSLNQTQLRKLMAFSSIAHTGWIMATITMAPKISTLTFTIYIMTTIPTFLLINTTMSMTIKDLGTMWTNSPYTMTILSMTILSMGGLPPLSGFMPKWLILNNLISMNMITEATLMAMASLLSLYVYMRLTYMSSMTLSPHTTTMPLKWRTSNKKHPMGTSMLTMMTMLLLPLSPNM