MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.147 kDa

MKLLFMYLLPLLYIAPILLAVAFLTLIERKILGYMQHRKGPNVVGPFGLLQPIADGVKLFIKEPIRPSTSSQLLFILAPTLALALAMIMWTPFPLPIPYSNLNLSILFILAISSLTVYTILGSGWASNSKYALIGALRAVAQTISYEVTLALIILCSVLLAGGFTLSAFAISQEFTWFILPLWPMFLMWFVSTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILMMNTLSTIIFLGSCMSSLTLTTSLLMTKASILSLCFLWVRASYPRFRYDQLMHLVWKNFLPLTLALVILYVSMPISLLFTPPLPWKRA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.59 kDa

MLNTLLTHLINPLAYIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPIRPSTASPTLFLVTPMLALTLAMTLWAPMPMPHPIIDLNLGVLFILALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILRSIIIFWGGYTVQTFNTTQEALWLLLPACPLAAMWYISTLAETNRAPFDLTEGESELAPGFNVEYAGGPFALLFLAEYANILLMNTLSAILFLGASHMPAIPELTTINLMTKAALLSVVFLWVRASYPRFRYDQLMHLVWKNFLPLTLALVLWHTALPIAFAGLPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.164 kDa

MLQHILLYLINPLAYIVPILLATAFLTLVERKILGYMQFRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPFLFLATPTLALTLALLMWMPLPLPHAIINLNLGLLFILAVSSLTVYTILGSGWASNSKYALMGALRAVAQTISYEVSLGLILLSMIIFTGGFTLHTFNLTQETVWLLVPGWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGSFALFFLAEYTNILMMNTLSVILFMGSSYDPTMPQISTFYLMMKATLLTLIFLWIRASYPRFRYDQLMHLVWKNFLPLTLALILWHAALPIATASLPPLT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.986 kDa

MQFTIFTHLTMALSYAVPILIAVAFLTLVERKVLSYMQARKGPNIVGPFGLLQPVADGVKLFIKEPVRPTTSSPILFIATPILALLLAITIWIPLPLPFSLTDLNLGLLFLLSMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVIMLSGNYTLNTLATTQEPLYLIFSTWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIMLMNTLTAILFLNPSSLNLPSELFPLILATKTLLLSSGFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCLWHTSLPISYAGIPPHL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.169 kDa

MTPLTLMNLMIMTLSYIIPILIAVAFLTLVERKILSYMQARKGPNIVGPFGLLQPIADGVKLFIKEPIRPSTSSPFLFIMTPILALLLALTIWIPLPLPFPMADLNLGLLFLLAMSSLTVYSLLWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSTIMLSGNYTLSTLSITQEPIYLIFSSWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIMLMNTLTITLFLNPSFLNLPSELFSITLATKVLLLSSSFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCLWHTSMPISYAGLPPA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.698 kDa

MITTLITHILNPLAFIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVRPSTSSPILFILTPMLALTLAMTLWAPLPLPYPVLDLNLAILLFVALSSLAVYSILGSGWASNSKYALVGALRAVAQTISYEVSLGLILLSLIIFTGGFTLQTFNTAQESIWLIIPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILFMNTLSASLFLGASHIPMLPELTTMNLMTKAAVLSLVFLWVRASYPRFRYDQLMHLIWKNFLPLTLALVIWHLALPITFAGLPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.476 kDa

MITTLITHVLNPLAYIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGLKLFIKEPVRPSTSSPFLFLATPMLALTLALTLWAPMPIPYPVTDLNLGVLFVLALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSVIIFTGGFTLQTFNIAQESIWLVVPAWPLAALWYISTLAETNRAPFDFTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSAILFLGATHIPALPELTAMNLMTKAALLSVVFLWVRASYPRFRYDQLMHLVWKSFLPMTLALVLWHLALPIALAGLPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.077 kDa

MTLPTLTNLLIMTLSYILPILIAVAFLTLVERKILSYMQARKGPNIVGPFGLLQPVADGVKLFIKEPIRPSTSSPFLFIITPILALLLALTIWVPLPLPFPLADLNLGLLFLLAMSSLTVYSLLWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSTIMLSGNYTLSTLAITQEPIYLIFSAWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMLMNTLTTVLFLNPSFLNLPPELFPIALATKTLLLSSSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCLWHTSMPISYAGLPPI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.157 kDa

MTLSTLTSLMIMTLSYMIPILIAVAFLTLVERKILSYMQARKGPNIVGPFGLLQPIADGVKLFIKEPIRPSTSSPFLFILTPILALLLALTIWTPLPLPFPMTDLNLGLLFLLAMSSLTVYSLLWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSTIMLSGNYTLSTLSITQEPMYLIFSSWPLTMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIMLMNTLTITLFLNPSFLSPPSELFSITLATKVLLLSSSFLWIRASYPRFRYDQLMHLLWKNFLPLTLAMCLWHTSMPISYAGLPPA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.615 kDa

MLNILMTHLINPLAYIVPVLLAVAFLTLIERKVLGYMQLRKGPNVVGPYGLLQPIADGVKLFIKEPVRPSTSSPFLFLAAPVLALTLAMTLWAPMPMPHPVTDLNLGILFILALSSLAVYSILGSGWALNSKYALIGALRAVAQTISYEVSLGLILLSVIIFSGGYTLQTFNITQESIWLLIPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSAVLFLGASHIPSVPELTTINLMTKAALLSIMFLWVRASYPRFRYDQLMHLVWKNFLPLTLAFVLWHTALPIALAGLPPQL

mt-nd1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.738 kDa

MLDILTSHLINPLAYAVPVLIAVAFLTLVERKVLGYMQLRKGPNVMGPRGLLQSVADGVKLFIKEPIRPSMASPILFLTAPVLALILAMMLWAPMPMPYPVLDLNLGILFIMAISSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSAVIFSGGYTLQTFNTTQEDTWLLLPLWPLAIMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYSNILLMNTHSTVLFLGASFTPDAPELMTISIATKTAMLSILFLWMRASYPRFRYDQLMHLIWKNFLPITLVLVLWHIALPIALAGLPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.605 kDa

MLNTLMTHLINPLAYIVPVLLAVAFLTLIERKVLGYMQLRKGPNVVGPYGLLQPIADGVKLFIKEPVRPSTSSPFLFLAAPVLALTLAMTLWAPMPMPHPVTDLNLGILFILALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSVIIFSGGYTLQTFNTTQESIWLLIPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSAVLFLGASHIPNMPELTTINLMTKAALLSILFLWVRASYPRFRYDQLMHLVWKNFLPLTLAFVLWHTALPIALAGLPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.452 kDa

MTTTLITHIINPLAYIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGLKLFIKEPVRPSTSSPFLFLATPMLALTLALTLWAPMPIPYPITDLNLGVLFVLALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSVIIFTGGFTLQTFNVAQESIWLLVPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSAILFLGASHIPAFPELTAVNLMTKAALLSVVFLWVRASYPRFRYDQLMHLVWKSFLPLTLALVLWHLALPTAMAGLPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

324 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.162 kDa

MLQTTLLYLINPLAYIIPILLATAFLTLIERKILGYMQFRKGPNIVGPYGLLQPIADGLKLFIKEPIRPSASSRSYFLATPTVALALALLMWMPLPLPHSIINLNLGLLFILAISSLTVYTILGSGWASNSKYALMGALRAVAQTISYEVSLGLILLSMIIFAGGFTLHTFNLAQETIWLLIPGWPLAFMWYISTLAETNRAPFDLTEGESELVSGFNIEYAAGPFALFFLAEYTNILLMNTLSVILFMGTSYNPLMPQISSLSLMMKASMLTVLFLWIRASYPRFRYDQLMHLVWKNFLPLTLAIILWHMALPLATTSLPPLT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

323 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.412 kDa

MTNIVVSYILNPLIYMVPVLLAVAFLTLIERKVLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPIRPSTSSPSLFVLPVLALTLALTLWAPMPMPFPVADLNLSILFVLALSSLAVYSILGSGWASNSKYALVGALRAVAQTISYEVSLGLILLSVIIFSGGFTLQTFSTTQEATWLALPAWPLAAMWYISTLEETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSAVLFLGSSYSTTMPEFTSLTLMTKAALLSMVFLWVRASYPRFRYDQLMHLVWKNFLPLTLALVIWHLSLSTACAGLPPHA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

323 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.729 kDa

MTKIITHLLNPLAVIIPILLAVAFLTLIERKVLGYMQLRKGPNIVGPYGLLQPLADGLKLFIKEPVRPSTSSPLLFITTPMLALTMALTLWLPLPLPHPMTNLNLGMLFILAISSLTVYSILGSGWASNLKYALIGALRAVAQTISYEVSLGLILLAMIIFAGGFTLTTFNTSQETIWLLTPGWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSTILFMGAMHNPITPELTSINLMIKASALSMLFLWVRASYPRFRYDQLMHLVWKNFLPITLAMILWHTSLPIFTGSLPPQT

mt-nd1

NADH-ubiquinone oxidoreductase chain 1

323 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.862 kDa

MLTIITHLINPLLYMIPILLAVAFLTLIERKVLGYMQHRKGPNIVGPTGLIQPIADGVKLFIKEPVRPSTSSQTMFLIAPTMALALAMSIWAPLPMPFSLADLNLGILFILALSSLAVYTILGSGWSSNSKYALIGALRAVAQTISYEVTLGLILLCMIMLAGGFTYTTLMTTQEQMWLIIPGWPMAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFSLAEYANILMMNTLSYLILFLGSSFMNQPELTTISLMIKSSILSMIFLWVRASYPRFRYDQLMHLVWKNFLPITLAMTLWHISLPISMLGLPSQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

323 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.357 kDa

MITLITHVINPLAYIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADGLKLFIKETVRPSTSSPFLFLATPMLALTLALTLWAPMPIPYPVTDLNLGVLFVLALSSLAVYSILGSGWASNSKYALIGELRAVAQTISYEVSLGLILLSVIIITGGFTLQTFNVAQESIWLLVPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSAVLFLGASHIPAFPELTALNLMTKAALLSVVFLWVRASYPRFRYDQLMHLVWKSFLPLTLALVLWHLALPIALAGLPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

322 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.094 kDa

MSIMMNLLQPLAFILPILIAVSFFTLVERKVISCMQPRKGPNITGPFGLLQPLADGLKLLFKEPVYPTNSSTTLFILTPTMALSLALSTWLPMPLPFSLVDLNLGLLFLLSMSSLMVFSILWSGWASNSKYALMGALRAVAQTISYEITLSLILLSMVLFSGGFNMRTFMTTQEQIYLIFSSWPLAMMWYISTLAETNRAPFDLAEGESELVSGFNVEYAGGPFAAFFMAEYTSILMMNTLSTILFLNPGFMYTSPTIFSISLMTTAVALSMGFLWIRATYPRFRYDQLMHLLWKNFLPITLAWCLWHISLLVTTSGIPPML

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

321 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.003 kDa

MISMILLNITNSLLYILSILIAVAFLTLLERKLLGYMQHRKGPNLVGPMGLLQPIADGLKLITKEATKPTMSSPILFTLSPIMALILALTSWAPMPMPTPLTNMNLGLLFIMAMSGMFTYAILWSGWSSNSKYPLMGAMRAVAQIISYEVTLGLIIISMAILSGGYSLMLFTETQEHMWLLLSSWPLAMMWFTSTLAETNRSPFDLTEGESELVSGFNVEFSAGPFALLFLAEYTNILFMNTLSTMMFLNPGMTNPQLFTINLMTKTMILTTLFLWTRASYPRFRYDQLMHLLWKQYLPLTLAMYLLNTSTSMALCGTPPQ

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

321 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.313 kDa

MLVMLTSTLILVLMVLLAVAFLTMVERKTLGYMQLRKGPNVVGFMGLLQPIADGVKLFLKEPVWPTAASPALFIAAPIMALTLALSLWMFIPMPQSISTINLTLLVILAISSLSVYASLGSGWASNSKYALIGALRAVAQTISYEVSLGLILLCLIILTGGFSLQAFIYTQEHTWFLLSSWPLAAMWFVSTLAETNRTPFDLTEGESELVSGFNVEYAGGPFALFFLAEYSNILFMNTLTAIMFLGPLGPNNLNILPIINVMMKATPLIILFLWIRASYPRFRYDQLMHLMWKNFLPLNLALFTLQLSLAVSLGGAGVPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

321 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.461 kDa

MDSLTIVPPALLIISILMAVAFLTALERKIMGHMQLRKGPNIVGPLGLLQPFADGLKLITKELTLPLLATPTLFILAPTAALMLALAMWSPLPMPSPLADLNLGLLLLLAMSSLMVYSFLWSGWSSNSKYALMGAMRAVAQTISYEVTLAIIVLSIVLLSGGFSLHTLTVTQEPLYLALATWPSMMMWYTSTLAETNRAPFDLTEGESELVSGFNVEYSASPFALFFLAEYANIMLMNTLTTTLFLSPSTPTFLPALFTIALMSKALLLTMSFLWVRASYPRFRYDQLMHLLWKNFLPMTLTLCLWHSSVPMSMFGLPPMT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

321 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.426 kDa

MSPSLVTLNSLMYIIPILIAVAFLTLTERKILGYMQHRKGPNITGPHGLLQPIADGLKLFIKEPVRPLNASPTLLILSPLLAITAAMLIWAPIPMPYSLANLNLGLLSILAISGMAVNSILWAGWASNSKYALIGSLRAVAQTISYEVTLGIILLSTLVLTGGFTIQLLTITQKYTWLLTTSWPLTMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIITMNLLTCILFINPGPSQYPELFLANLIAKTTILCLSFLWIRASYPRFRYDQLMHLLWKQFLPMTMALCLLHASLSISISGLPPHP

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

321 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.713 kDa

MPLTMTITNSLMYIIPILIAVAFLTLMERKMLGYMQLRKGPNITGPYGLLQPIADGLKLFTKEPIRPLNTSPILLILSPMLALTTALLIWTPIPMPHALTNLNLGLLSTLAISSMAVNSTLWAGWAPNSKYALIGSLRAVAQTISYEVTLGIILLSTLMLTGGFTMQLLTTTQKHTWLLTTSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYTNIISMNLLTCILFINPGPTQHPELFLTNLIIKTMILSMSFLWIRASYPRFRYDQLMHLLWKQFLPLTMALCLLHTSLSISISGIPPLS

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

321 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.474 kDa

MLIMLTSTLILVLMVLLAVAFLTMVERKTLGYMQLRKGPNVVGFMGLLQPIADGVKLFLKEPVWPLAASPILFIVAPIMALTLALSLWMLIPMPQSISTINITLLVIMAISSLSVYAILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLCLVILTGSFSLQAFIYTQEHTWFLLSSWPLAAMWFVSTLAETNRTPFDLTEGESELVSGFNVEYAGGPFALFFLAEYSNILFMNTLTAIMFLGPLGSNNLNILPIINIMMKATPLIILFLWIRASYPRFRYDQLMHLMWKNFLPLNLALFTLQLSLAVSFGGAGVPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

320 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.626 kDa

MSLITIINPLTYIVPILIAVAFLTLTERKILGYMQLRKGPNITGPYGLLQPIADGLKLFIKEPVRPLNTSPILLILSPVLALTMAMLIWTPIPMPYTLANLNLGFLSILAISSMAVNSILWAGWASNSKYALIGSLRAVAQTISYEVTLGIILLSILILTGGFTMQLLTATQKHIWLLATSWPLMMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIISMNLLTCILFINPGPTQHPELFLINLITKTMILTLTFLWIRASYPRFRYDQLMHLLWKQFLPLTMALCLLHVSLLISISGLPPLT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

319 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.418 kDa

MLPTTINSLMYIIPILIAVAFLTLMERKMLGYMQLRKGPNITGPYGLLQPIADGLKLFTKEPIRPLHTSPTLLISSPILALTTAMLIWTPIPMPYALTNLNLGLLSILAISSMAVNSILWAGWASNSKYAIIGSLRAVAQTISYEVTLGIILLSILILTGGFTMQLLTTTQEFTWLLTTSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLTEYANIIVMNLLTCILFISPGPPQHPELFLINLITKTMILSLSFLWIRASYPSFRYDQLMHLLWKQFLPLTMSLCLLHTSLPISTSGIPPLS

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

319 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.292 kDa

MTLITLIINPLMYIIPILLAMAFLTLVERKMLGYMQLRKGPNIVGPYGLLQPIADGVKLFIKEPVKPSTSSPTLFLLTPTLALTLALILWIPLPMPLALTDLNLTILFILAVSSLSVYSILGSGWASNSKYALIGALRAVAQTISYEVTLGLIIISLIMFTGGFTLTTFNTAQEAVWLILPAWPLAAMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYTNILLMNALSTILFLGPSFNTLTINLNWAIKTMILASMFLWVRASYPRFRYDQLMHLVWKNFLPLTLALITWHISLPISMAGSPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.821 kDa

MFLINVLTVTLPILLAVAFLTLVERKALGYMQLRKGPNVVGPYGLLQPIADAIKLFTKEPIYPQTSSKFLFTVAPILALTLALTVWAPLPMPYPLINLNLSLLFILAMSSLMVYSILWSGWASNSKYALMGALRAVAQTISYEVSMTTITLSMVLMNGSFTLTAFAMTQEHLWLILPMWPLMMMWFTSTLAETNRAPFDLTEGESELVSGFNVEYSAGPFALFFMAEYANIIMMNALTVILFMGTSYDPQMPEISTINFVMKTIILTICFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISVLISLACIPPQA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.895 kDa

MFVINLLLYIIPILLAVAFLTLVERKDLGYMQFRKGPNIVGPYGLLQPVADGIKLFTKEPLRPLTSSFNMFIIAPILALTLARTIWTPLPMPHTLIDLNLGLLFILSLSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLKNLLITQENMWLIVSTWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIAMNAMTAILFLGSSLNHNFSQLSTLSFMLKTLFLTFMFLWIRASYPRFRYDQLMYLLWKNFLPLTLALCLWFISIPIALSCIPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.709 kDa

MFVINLLLYIVPILLAVAFLTLVERKVLGYMQFRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSVSMFIIAPILALTLALTIWTPLPMPHALIDLNLGLLFILSLSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLKNLIITQENMWLIVATWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMAMNAMTAILFLGSSLNHNLSHLNTLSFMLKTLFLTFMFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCLWFISIPIALSCIPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.802 kDa

MFIINLLLYIVPILLAVAFLTLVERKVLGYMQFRKGPNIVGPYGLLQPIADGIKLFTKEPLRPLTSSVSMFIIAPILALTLALTIWTPLPMPHTLIDLNLGLLFILSLSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLKNLLITQENMWLIVSTWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMAMNAMTAILFLGSSLNHNFSHLSTLSFMLKTLFLTFMFLWIRASYPRFRYDQLMYLLWKNFLPLTLALCLWFISIPIALSCIPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.802 kDa

MFLINVLTVTLPILLAVAFLTLVERKALGYMQLRKGPNVVGPYGLLQPIADAIKLFTKEPVYPQTSSKFLFTIAPILALTLALTVWAPLPMPYPLINLNLSLLFILAMSSLMVYSILWSGWASNSKYALMGALRAVAQTISYEVSMTTIILSMVLMNGSFTLTAFATTQEHLWLIFPMWPLMMMWFTSTLAETNRAPFDLTEGESELVSGFNVEYSAGPFALFFMAEYANIIMMNALTVILFMGTSCNPQMPEISTINFVVKTMILTICFLWVRASYPRFRYDQLMYLLWKNFLPLTLALCMWHISILISLACIPPQA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.651 kDa

MSIINLLTTIIPVLLAVAFLTLAERKVLGYMQLRKGPNIVGPWGLLQPIADAVKLFTKEPLRPLTSSIMMFIMAPILALALALTMWMPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGANRAVAQTISYEVTLAIILLSVLLMSGSFTLSTLIITQEKLWLLVPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNALSTTLFLGGFHNSYNPSLYTTNFIMKVLILTMAFLWIRASYPRFRYDQLMHLLWKNFLPLTLAMCMWYISMPIAMSSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.796 kDa

MFLINLLIYIIPILLAVAFLTLIERKVLGYMQLRKGPNVIGPYGILQPFADAVKLFTKEPLRPLTSSISMFIIAPILALTLALTIWTPLPMPHTLIDLNLGLLFILSLSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLKNLMITQENMWLIMTAWPLTMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMAMNAMTTILFLGPPLNHNHTYTCTISFMFKTMLLTSAFLWVRASYPRFRYDQLMYLLWKSFLPITLALCLMFISIPIALSSIPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.872 kDa

MYLINLLAMIIPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLQPLTSSPMLFIIAPTLALTLALTMWTPLPMPYPLMNMNLSMLFILALSSLAVYTIMWSGWASNSKYALIGALRAVAQTISYEVTLAIIILSLLLMNGSFTLLSMTTTQEYIWLLIPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNALTIILFLGAYHNPMVPELYTINFTTKTLLFTAFFLWIRASYPRFRYDQLMHLLWKNFLPLTLVMCMWHVALPIMLAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.86 kDa

MYLINLLAMIVPVLLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLQPLTSSPMLFIIAPTLALTLALTMWTPLPMPYPLMNMNLSMLFILALSSLAVYTIMWSGWASNSKYALIGALRAVAQTISYEVTLAIIILSLLLMNGSFTLLSMTTTQEYIWLLIPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNALTIILFLGAYHNSMVPELYTINFTIKTLLFTAFFLWIRASYPRFRYDQLMHLLWKNFLPLTLVMCMWHVALPIMLAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.432 kDa

MFMINIACLIIPILLAVAFLTLVERKTLGYMQVRKGPNIVGPHGLLQPIADAVKLFTKEPLRPLTSSKLLFTVAPTLALTLALTMWLPLPMPHSLINLNLGVLFILAISSLAVYSILWSGWASNSKYALIGALRAVAQTVSYEVTLAIILLSVLLMSGSFTLTNLITTQEHMWLIIPTWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIMMMNALTTLLFLGALHTPLVPGIYTANFVLKTLILTIMFLWIRASYPRFRYDQLMHLLWKNFLPLTLAMLMWHVSSPMSLASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.692 kDa

MISQIISSFLTFVMILIAVAFLTLIERKVLGYMQLRKGPNIVGPFGLLQPFADGIKLFIKEPLQPSYASIFLFILAPALAISLALILWISLPLPLALSDMNLGLMFILAISSLSVYSLLTSGWASNSKYALMGALRAVAQTISYEVTLGLMIVALTILSGGFDLKLFIDLQNKIWLLFPMWPIFLMWFISTLAETNRSPFDLTEGESELVSGFNVEFSGGLFALFFLAEYANILFMNSLTVVLFMGSSNLSSLYFSASMTMKTMFLIFLFLWVRASYPRFRYDQLMHLMWKNFLPITLSLLIFQFSMSLFFGVSPSAI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.89 kDa

MFMINVLLLIIPILLAVAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADALKLFIKEPLQPLTSSTSMFIIAPILALTLALTMWIPLPMPYPLINMNLGILFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFTLSTLIITQEYLWLIFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNIFTTTLFLGAFHSPYLPELYSINFTMKTLLLTCSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPIMLSSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.818 kDa

MFLMNILCLVIPILLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPLTSSKLMFTLAPTLAFTLALSLWIPMPMPHPLINLNLGVLFILALSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMMMNGSFTLSTLTTTQEHMWLIFPLWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTTTLFLGAFHNPLFPELFTVNFITKTLILTMMFLWVRASYPRFRYDQLMHLLWKSFLPLTLALCMFHVSMPALSAGVPPHM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.874 kDa

MFMINVLSLIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAVKLFTKEPLRPLTSSMLMFIMAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLAMLITTQEYMWLIIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFDVEYAAGPFALFFLAEYANIIMMNILTTILFFGAFHSPYMPELYTINFTVKTLLLTTTFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPIITASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.741 kDa

MSMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPSTSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMNGSFNLSTLIMTQEHLWLLLPTWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPLALFFMAEYMNIIMMNTLTTMIFLGTTYNAHSPELYTVCFITKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYISMPTTISSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.878 kDa

MFMINIISLIIPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSTTMFIMAPILALTLALTMWVPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEHLWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIMMNIFTTLLFFGAFHNPYMPELYVVNFTVKTLALTILFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVTLPIISASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.928 kDa

MFIINTLMLVAPILLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPFADAIKLFTKEPLRPSTSSVSMFIIAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSILLMNGSFTLSTLITTQEKLWLIFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFMAEYINIIMMNAFTTVLFLGTCYNPYLPELYTINFTIKTLLLTMSFLWIRASYPRFRYDQLMHLLWKSFLPLTLALCMWHVSLPIMTSSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.719 kDa

MFMINLLLMIVPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFTKEPLRPLTSSISMFIIAPILALALALTMWTPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLLNGSFTLPTLITTQEHMWLIIPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNIFTTILFLGAFHNPLMPELYTINFVTKSMLLTISFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVTMPIITAGVPPLT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.74 kDa

MFMINLLMMIVPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFTKEPLRPLTSSISMFIMAPILALTLALTMWTPLPMPYPLINMNLGILFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLLSGSFTLPTLITTQEHIWLIVPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNIFTTILFLGAFHNPLMPELYTINFVTKSMLLTISFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVTMPIITAGVPPLT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.841 kDa

MFMINVLLLIVPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADALKLFIKEPLQPLTSSTSMFIIAPILALTLALTMWIPLPMPYPLINMNLGILFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFTLSTLIITQEYLWLIFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNIFTTTLFLGAFHNPYLPELYSINFTIKALLLTCSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPIMLSSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.741 kDa

MFMLNLLTMIVPVLLAVAFLTLVERKILGYMQLRKGPNVVGPHGLLQPIADAVKLFTKEPLRPLTSSITMFIMAPILALTLALTMWIPLPMPHPLLNMNLGVLFMLAMSSLAVYALLWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSTLLMSGSYSLSTLIITQEYIWLILPSWPLTMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNALTTTLFLGAWNNPTTPELYTTNFAMKTLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWYVTMPIMMAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.661 kDa

MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.815 kDa

MPMINLLLLILPTLIAMAFLMLTERKILGYTQLRKGPNIVGPYGLLQPFADAMKLFTKEPLKPSTSTTALYIIAPTLALTIALLLWTPLPMPNPLINLNLGLLFILATSSLTVYSILWSGWASNSNYALIGALRAVAQTISYEVTSAIILLSVLLMSGSFNLSTLITTQEHIWLLLPTWPLAMMWFISTLAETNRTPFDLTEGESELVSGFNTEYAAGPFALFFMAEYVNIIMMNALTTMIFLGTTHNAHRPELYTTCFTIKTLLLTSLFLWIRTTYPRFRYDQLMYLLWKNFLPLTLTLLMWYISLSTMIASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.797 kDa

MFMINLFLLIIPILLAMAFLTLAERKILGYMQLRKGPNVVGPHGMIQPFADAMKLFIKEPLRPLTSSSSLYTIAPTLALTIALVTWIPLPLPYPLINMNMGLLFILATSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEFTLAIILLSLLLMNGSFTLSTLITTQEYLWLIIPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTTTLFLGALYNLHMPETYTTSFAIKTLLLTILFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWYVSLPVLASCIPPQA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.304 kDa

MLPITNSLTYIIPILIAVAFLTLTERKILGYMQLRKGPNITGPYGLLQPIADGLKLFIKEPIRPLNTSPTLLILSPILALTTAMLIWTPIPMPHALTNLNLGLLSILAISSMAVNSTLWAGWASNSKYALIGSLRAVAQTISYEVTLGIILLSILILTGGFTMQLLTTTQKHIWLLTTSWPLTMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYTNIISMNLLTCIMFINPGPTQHPELFLINLVTKTLLLSLTFLWIRASYPRFRYDQLMHLLWKQFLPLTMALCLLQASLLVSISGIPPLP

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.635 kDa

MFIINLLLYIVPILLAVAFLTLVERKVLGYMQFRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSISMFIIAPILALTIALTIWTPLPMPHTLIDLNLGLLFILALSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLKNLIITQENMELIVTTWPLAMMWYVSTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMVMNAMTTILFLGSSLNHNFTHLNTLSFMTKTLALTLLFLWIRASYPRFRYDQLMHLLWKSFLPITLALCLWFISIPVALSCIPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.6 kDa

MFLMNILCLVIPILLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPLTSSKLMFTLAPTLAFTLALSLWIPMPMPHSLINLNLGVLFILALSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVMMMNGSFTLSTLTTTQEHMWLILPLWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTATLFLGAFHNPLFPELFTVNFITKTLILTAIFLWVRASYPRFRYDQLMHLLWKSFLPLTLALCMLHVSIPALSAGVPPHM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.71 kDa

MFILNLLLYIIPILLAVAFLTLIERKVLGYMQFRKGPNIVGPYGLLQPFADAVKLFTKEPLRPLTSSILMFILAPILALSIALTIWTPLPMPNSLLDLNLGLLFILSLSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVSLAIILLSVMLINGSFTLKTLSTTQENWWLIITTWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVDYAAGPFAMFFLAEYANIIAMNAITTILFMGSSLTLNLTHIDSITFMMKTLLLTMAFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCLWYISLPIALSCIPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.697 kDa

MFTLNLLLYIIPILLAVAFLTLIERKVLGYMQFRKGPNIVGPYGLLQPFADAVKLFTKEPLRPLTSSILMFILAPILALSIALTIWTPLPMPNTLLDLNLGLLFILSLSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVSLAIILLSVMLINGSFTLKTLSTTQENWWLITTTWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIAMNAITTILFLGSSLTTNLNHIDTISFMLKTLLLTMAFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCLWYISLPIALSCIPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.931 kDa

MFLINLLLLIVPVLLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPLTSSIYMFILAPILALSLALTIWVPLPMPLPLIDLNLGLLFILSVSGLSVYSILWSGWASNSKYALTGALRAVAQTISYEVTLAIILLSIMLINGSFTLTTLNLTQEFMWLVVPTWPLMLMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGTYHLIFLPELSTTNFMVKTMLLTSLFLWVRASYPRFRYDQLMHLLWKNFLPITLVTCLWYIMFPTMLSGTPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.757 kDa

MFLMNLLSMIIPILLAVAFLTLVERKILGYMQLRKGPNIVGPHGLLQPIADAIKLFTKEPLQPLTSSTTMFIMAPILALTLALTMWIPLPMPYPLINMNLGILFMLAMSSLAVYAILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIVTQEYTWLIFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNILTTTLFLGAYHSPTMPELYTTNFVTKTLLLTTTFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSMPITMASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.811 kDa

MFLMNLLLLIIPILVAMAFLTLVERKMLGYMQLRKGPNIVGPYGLLQPFADAMKLFIKEPLKPLTSSISLFIIAPSLALTLAFTMWIPLPMPQPLINMNMGILFILATSSLAVYTILWSGWASNSKYALFGALRAVAQTISYEVTLAIILLSVLLLNGSFTLSSLITTQQFTWLLLPTWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTTTIFMGALLNPLNPEMFTFSFTLKTLMLTATFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISLPVIMACIPPLT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.5 kDa

MFMINIACLIVPILLAMAFLTLVERKTLGYMQLRKGPNIVGPHGLLQPFADAVKLFTKEPLRPLTSSKLLFMVAPTLALTLALTMWAPLPMPYSLISLNLGLLFILAISSLAVYSILWSGWASNSKYALIGAIRAVAQTVSYEVTLAIILLSILLMSGSFTLTNLITTQEQMWLIIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIMMMNALTTLLFLGAHHTPLVPEAYTANFVLKTLMLTATFLWIRASYPRFRYDQLMHLLWKNFLPITLAMLMWHVSLPMSLASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.698 kDa

MFLINLLLMIVPILLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLWPLTSSATMFIIAPILALSLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYAILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLLNGSFTLPTLIITQEHLWLIVPSWPLTMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIMMNIFTTTLFLGAYHNPIMPELYSVNFTLKATALTIMFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVALPILTAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.689 kDa

MFLMNMLCLIIPILLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPLTSSKLMFTLAPMLAFSLALSMWIPMPMPHPLIHLNLGVLFILALSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSTMMMNGSFTLSTLTTTQEHMWLIFPLWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMKALTTTLFLGALHNPLLPELFTANFVTKTLALTMAFLWIRASYPRFRYDQLMHLLWKSFLPLTLALCMLHVSLPTVSAGIPPHM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.883 kDa

MFIINLLLYIIPILLAVAFLTLVERKALGYMQFRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSISMFIIAPILALTLAFTIWTPLPMPHSLIDLNLGLLFILALSGLSVYSILWSGWASNTKYALMGALRAVAQTISYEVTLAIILLSIMLINGSFTLKNLIITQENMWLIMTTWPLTMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMAMNAMTTILFLGSSINHNFTHLNTLSFVIKTALLTFMFLWVRASYPRFRYDQLMYLLWKNFLPLTLAFCLWFISIPVALSCIPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.875 kDa

MFMINLFSLIIPILLAVAFLTLVERKTLGYMQLRKGPNVVGPYGLLQPFADAIKLFTKEPLRPLTSSKFMFTIAPALALTLALTMWVPLPMPYPLINMNLSMLFILAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVSLAIILLPTMLMNGSFTLSTLTTTQEHLWLIFPLWPLAMMWFVSTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMTEYANIIMMNALTAILFLGTFHNPLLPEAHTINLILKTSLLTICFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWHMSIPIMLACIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.789 kDa

MFLINVLTVTLPILPAVAFLTLVERKALGYMQLRKGPNVVGPYGLLQPIADAIKLFTKEPIYPQTSSKFLFTVAPILALTLALTVWAPLPMPYPLINLNLSLLFILAMSSLMVYSILWSGWASNSKYALMGALRAVAQTISYEVSMTTITLSMVLMNGSFTLTAFATTQEHLWLIFPMWPLMMMWFTSTLAETNRAPFDLTEGESELVSGFNVEYSAGPFALFFMAEYANIIMMNALTVILFMGTSCDPQMPEISTINFVMKTIILTICFLWVRASYPRFRYDQLMYLLWKNFLPLTLALCMWHISILISLACIPPQA

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.631 kDa

MFLVNLLLMIIPILLAVAFLTLLERKTLGYMQLRKGPNIVGPHGLLQPIADAIKLFTKEPLRPLTSSTSMFIMAPILALSLALTMWTPLPMPYPLINMNLGVLFILAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFSLPNLSTTQENLWLIIPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGSFALFFLAEYANIIMMNAITTTLFLGLYQNPSLPEFYTTSFMIKTLLMTITFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSIPILTASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.713 kDa

MYFMNLLTTIIPILLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADAIKLFTKEPLQPLTSSHVLFIIAPTLALTLALMMWIPLPMPHPLTNMNLSILFMLALSSLAVYGIMWSGWASNSKYALIGALRAVAQTISYEVTLAIIILSILLMNGSFALSTLITTQEHIWLILPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPSALFFLAEYANIIMMNALTIILFLGAHNNPMFPELYTTNFMIKALVLTTLFLWVRASYPRFRYDQLMHLLWKNFLPLTLVMCMWHVTLPIILAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.688 kDa

MFTINILLLVIPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADAIKLFTKEPLQPSTSSTTMFIIAPILALTLALTMWIPLPMPHPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLITTQEHLWLIFPSWPLAMMWFISTLAETNRAPFDLAEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNAFTTILFLGAFHNPHMPELYTINFTTKTLLLTTSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPITTSSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.584 kDa

MLTTNILCLIIPILLAVAFLTLVERKILGYMQFRKGPNIVGPYGLLQPAADATKLFTKEPLHPLTSSKFMFTIAPTLALTLALTLWIPLPMPYPLIDLNLGILFILAVSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSLVLTNGSFTLSTLTTTQEHMWLVLPTWPLTMMWFTSTLAETNRAPFDLSEGESELVSGFNVEYAAGPFALFFMAEYANIILMNSLTTALFFGAFHNPSLPELHTINFITKTLILTTMFLWIRASYPRFRYDQLMHLLWKNFLPLTLAMCMWHVSTSISFASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.573 kDa

MFMINLLLTIVPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAVKLFTKEPLRPLTSSITMFIIAPILALTLALTMWTPLPMPHPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLLSGSFALPALITTQEHMWLIIPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNIFTTILFLGAFHNPLMPELYTINFALKATLLTISFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVTMPIITAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.699 kDa

MFLTNISCLIIPILLAVAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFTKEPLRPLTSSKLLFTIAPTLALSLALTLWIPLPMPHPLANLNLGMLFILAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLHSNLFSGSYSLSSLITTQEHIWLIIPSWPLTMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIMMMNALTTTIFLGPTYNPTFPELYSTNFMLKTTMLTISFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHTSLLISLTSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.551 kDa

MHLINILCLIIPILLAVAFLTLLERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPATSSKLMFTLAPTLALTLALSLWIPIPMPYPLVNLNLGVLFILAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMMTNGSFTLSNLTTTQEHMWLILPLWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNALTAILFFGALHNPMFPELHTLNLITKTLILTMTFLWVRASYPRFRYDQLMHLLWKSFLPLTLALCMFHVSAPATFAGVPPHM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.582 kDa

MYLINVLSLIIPILLAVAFLTLLERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPATSSKLMFTLAPTLALTLALSLWIPIPMPYPLVNLNLGVLFILAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMMTNGSFTLSTLTTTQEHMWLIFPLWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNALTAILFFGAMHNPMFPELHTLNLITKTLILTMMFLWVRASYPRFRYDQLMHLLWKSFLPLTLALCMLHVSAPATFAGVPPHM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.58 kDa

MFLTNLLMTIAPVLLAVAFLTLVERKILGYMQLRKGPIVVGPYGLLQPISDAVKLFTKEPLRPLTSSTTMFLMAPTLALALALTMWIPLPMPLPLTNMNLSLLFMLAMSSLAVYAILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSVLLLSGSYSLSTLIITQEYMWLILPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYTNIIMMNALTTILFLGAYNNPNTPELYTINFTTKTLLLTMAFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWYTALPIITAAIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.923 kDa

MFLINLLMYIIPILLAVAFLTLVERKVLGYMQFRKGPNVIGPYGILQPFADALKLFIKEPLRPMTSSISMFTIAPTLALTLAFTIWTPLPMPNALLDLNLGLLFILALSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLKNMLITQENMWLIMMTWPLTMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMVMNAITATLFLGSPLSSNIPYINSMTFMMKMLILTTTFLWIRASYPRFRYDQLMYLLWKNFLPITLALCLWYISIPISLSSLPPQL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.921 kDa

MFIMNLLLYIIPILLAVAFLTLIERKVLGYMQFRKGPNVVGPYGLLQPFADAVKLFTKEPLHPLSSSVLMYTLAPTLALTLALTIWTPLPMPYSLVDLNLGLLFILALSSLSVYSILWSGWASNSKYPLAGALRAVAQTISYEVTLAIILLSIMMINGSFTLKNLIITQENMWLIVPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYTAGPFAMFFLAEYANIIIMNALTTMLFLGPSFNQDFTHVNTFTFMTKMMILTLTFLWVRASYPRFRYDQLMQLLWKNFLPMTLALCLWFISIPMALACVPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.804 kDa

MFMVNLLMLVIPVMLAMAFLTLLERKTLGYMQFRKGPNVVGPNGLLQPFADAMKLFIKEPLQPLTSSTSLYIIAPTLALSIALIMWTPLPIPYPLVNINLGVLFILATSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLCILLMSGSFTLSTLIKTQEHTWLLLPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTATIFMSAIHSMNFPEFFSINFTLKTLLLTTIFLWVRASYPRFRYDQLMHLLWKNFLPLTLAMCMWHTALPIFLANIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.965 kDa

MYFVNLLTTIIPILLAVAFLTLLERKFLGYMQLRKGPNIVGPYGLLQPITDAVKLFIKEPLQPLTSSLILFIIAPTLALTLALMMWIPLPMPHPLVNMNLSILFMLALSSLAVYAILWSGWASNSKYALIGALRAVAQTISYEVTLAIIILSVLLMNGSFTLSTLITTQEHIWLLLPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNALTTILFLGAHNNSLFPEMYTTNFMLKTLLFTTFFLWIRASYPRFRYDQLMHLLWKNFLPLTLVMCMWHITLPIILASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.904 kDa

MFLVNLLILIIPVLLAVAFLTLLERKILGYMQFRKGPNIVGAHGLLQPIADAVKLFTKEPLRPLTSSIYMFILAPILALSLALTIWIPLPMPLPLIDLNLGLLFVLSVSGLSVYSILWSGWASNSKYALTGALRAVAQTISYEVTLAIILLSIMLINGSFTLTTLNLTQEYMWLIVPTWPLMLMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGTYHLIFLPEMSTTTFMIKTMLLTSLFLWIRASYPRFRYDQLMHLLWKNFLPITLVTCLWYIMLPTTLSGLPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.72 kDa

MPMTNLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNIVGPYGLLQPFADAMKLFTKEPLKPSTSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLVTTQEHLWLILPTWPLAMMWFISTLAETNRTPFDLTEGESELVSGFNIEYAAGPFALFFMAEYMNIIMMNTLTATIFLGATYNTHSPELYTTYFVTKALLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLASLMWYISMPTTISSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.707 kDa

MTTMNLLLLIMSTLAAMAFLTLVERKLLGYMQLRKGPNIVGPYGLLQPFADAMKLFTKEPLKPSTSSTILYITAPALAFSIALLLWTPLPMPNPLINFNLGLLFILATSSLTVYSILWSGWASNSNYALIGALRAVAQMISYEVTLSIILLSILLTSGSFNLNMLITTQEHLWLILPSWPLAMMWFTSTLAETNRTPFDLMEGESELVSGFNIEYSAGPFALFFMAEYMNIIMMNALTTTIFLGTFYPTHSPELFTTSFTIKTLLLTSLFLWIRAAYPRFRYDQLMHLLWKSFLPLTLALLMWSTSMPIAISSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.839 kDa

MFIINLLLYIVPILLAVAFLTLIERKVLGYMQFRKGPNIVGPYGLLQPFADAVKLFTKEPLRPLTSSISMFIIAPILALTLALTIWVPLPMPYSLIDLNMGLLFILALSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLKTLITTQENMWLIVTTWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIVMNAMTTILFLGTSINQNFTHLNTLSFMMKTLTLTIVFLWIRASYPRFRYDQLMHLLWKNFLPITLACCLWFISMPIALSCIPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.613 kDa

MLTINILLYTSPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPVADAVKLFTKEPSRPATSSTLMFITAPIMALTLALTIWVPLPMPHALIDLNLGVLFILTLSGLSVYPILWSGWASNSKYALIGALRAVAQTISYEVTLAMILLSITLINGSYTLKNLAITQENMWLLVSTWPLAMMWFISTLAETNRTPFDLTEGESELVSGFNVEYSAGPFAMFFLAEYTNILAMNAMTTILFLGSPINHNFTHINTLSFTLKTLMLTFLFLWIRASCPRFRYDQLMHLLWKNFLPLTLAFCLWYISIPIALSCIPPQI

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.85 kDa

MFMINIISLIIPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSTTMFIMAPILALALALTMWVPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEHLWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIMMNIFTTLLFFGAFHNPYMPELYVINFTVKTLALTILFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVTLPITSASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.633 kDa

MYLITLLSTIVPILLAVAFLTLVERKILGYMQLRKGPNVVGPYGLLQPIADAVKLFTKEPLRPLTSSVSMFIIAPILALALALTMWTPLPMPHPLINMNLGILFMLAMSSLAVYAILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSILLMSGSYSLTTLITTQEYIWLILPSWPLTMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNALTTILFLGAYNNPMAPELYTTNFATKTLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWYVTMPIMLASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.816 kDa

MFMVNLLLLIIPALIAMAFLTLTERKILGYMQFRKGPNIVGPYGMLQPIADAMKLFMKEPLLPTTSASTLYMTAPTLALSIALLMWSPLPMPHPLINFNLGLLFMLATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLQSLITTQEHSWLLLPSWPMAMMWFTSTLAETNRAPFDLTEGESELVSGFNIEYAAGSFALFFMAEYMNIIMMNALTTTIFLAMPYNMASSELYTMNFMTKTLLLTTLFLWIRTAYPRFRYDQLMHLLWKKFLPLTLALCMWYISMPALTSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.766 kDa

MFMINILTLILPILLAVAFLTLVERKILGYMQFRKGPNIVGPHGLLQPFADAIKLFTKEPLRPATSSTTMFIIAPVLALALALTMWSPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSYTLSTLATTQEQLWLLFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNMFTAILFLGTFHNPCNPELYTTNLIIKTLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISLPIMTASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.766 kDa

MFMINILTLILPILLAVAFLTLVERKILGYMQFRKGPNIVGPHGLLQPFADAIKLFTKEPLRPATSSTTMFIIAPVLALTLALTMWSPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSYTLSTLATTQEQLWLLFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNMLTAILFLGTFHNPHNPELYTANLIIKTLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISLPIMTASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.682 kDa

MFMINILMLIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSASMFILAPIMALGLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFTLSTLIITQEQMWLILPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTAILFLGTSHNPHMPELYTINFTIKSLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILTSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.652 kDa

MFMINILMLIIPILLAGAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSTSMFILAPILALGLALTMWIPLPMPHPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFTLSTLIITQEQTWLILPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNMFTAILFLGTSHNPHMPELYTINFIIKSLLLTMLFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILTSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I subunit 1 family.

35.67 kDa

MFMINILMLIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSASMFILAPIMALGLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFTLSTLITTQEQMWLILPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTAILFLGTSHNPHMPELYTINFTIKSLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILTSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.629 kDa

MLLTNILCLMMPILLAVAFLTLTERKILGHMQLRKGPNTVGPHGLLQPVADAVKLFTKEPLHPLTSSKLMFIIAPTLAFTLALSLWAPLPMPHPLINLNLSILFILAMSSLAVHSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMLINGSFTLSTLTITQEQMWLILPTWPLAMMWFISTLAETNRTPFDLSEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTATLFFGAFHNPLFPELHTINLTTKTLILVFLFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCTWHMTMPISLAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.892 kDa

MFFINIISLIIPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSMSMFILAPILALSLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEHMWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNILTTILFFGAFHNPFMPELYSINFTMKTLLLTICFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVALPIITASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.892 kDa

MFFINIISLIIPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSMSMFILAPILALSLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEHMWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNILTTILFFGAFHNPFMPELYSINFTMKTLLLTICFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVALPIITASIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.648 kDa

MFMINILSLIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADALKLFTKEPLRPATSSISMFIIAPILALSLALTMWVPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSYTLSTLITTQEHIWMIFTSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFMAEYANIIMMNAFTAILFLGASHDPHTPELYTINFVLKTLALTITFLWIRASYPRFRYDQLMHLLWKSFLPLTLALCMWHISLPIMTASIPPQS

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.512 kDa

MPMINLLLLIMSILIAMAFLMLTERKILGHTQLRKGPNIVGPYGLLQPFADALKLFTKEPLKPSTSTITLYIISPALALTIALLLWTPLPMPIPLINLNLGLLFILAASSLTVYSILWSGWASNSNYALIGALRAVAQTISYEITLALILLSVLLMSGSFNLSALITTQEHSWLLLPSWPLALMWFISTLAETNRAPFDLTEGESELVSGFNTEYAAGPFALFFMAEYTNIILMNALTTMIFLGTTFNIHSPELYTTLFTIKTLLLTSLFLWIRSTYPRFRYDQLMHLLWKNFLPLTLALLMWHISVPIATSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.517 kDa

MPVINLLLLTMSILIAMAFLMLTERKILGYTQLRKGPNIVGPCGLLQPFADALKLFTKEPLKPSTSTTILYIVSPALALTIALLLWTPLPMPNPLINLNLGLLFILATSSLTVYSILWSGWASNSNYALIGTLRAVAQTISYEITLALILLSVLLMSGSFNLSTLITTQEHSWLLLPSWPLALMWFISTLAETNRAPFDLTEGESELVSGFNTEYAAGPFALFFMAEYTNIILMNALTAMIFLGTTFNIHSPELHTTLFTIKTLLLTSLFLWIRSTYPRFRYDQLMHLLWKNFLPLTLALLMWHISMPITTSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.698 kDa

MFLMNILCLIIPILLAMAFLTLVERKILGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPLTSSKTMFILAPTLAFSLALSMWIPMPMPHPLVNLNLGVLFILALSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMMLNGSFTLSTLTTTQEHLWLIFPLWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTTILFLGALHNPLFPELFTVNFVTKTLLLTVTFLWVRASYPRFRYDQLMHLLWKSFLPLTLALCMLHVSTPTMLAGIPPHM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.661 kDa

MFMVNLLTMIVPILLAVAFLTLIERKVLGYMQLRKGPNVVGPYGLLQPMADALKLFIKEPLRPLTSSPSMFIIAPILALTLALTMWIPLPMPHPLINMNLAVLFMLAMSSLAVYSILWSGWASNSKYALIGAMRAVAQTISYEVTLAIILLSVLLLSGSFSLSTLITTQEHTWLMLSSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFMAEYANIIMMNTLTAILFTGAFHNPLMPELYTINLIIKALLLTVFFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVAMPITMAGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.775 kDa

MFLINTLLLILPVLLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFTKEPLRPLTSSPLLFIIAPTLALTLALSMWLPIPMPYPLVNLNMGILFILATSSLAVYSILWSGWASNSKYALFGALRAVAQTISYEVTLAIILLCILLMNGSFTLSSLITTQEYMWILLPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYTNIILMNALTAILFLGSFHSHTNPEMFTVNFATKTLLLTMTFLWIRASYPRFRYDQLMHLLWKSFLPLTLALCMWHISMPIMLSSIPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.848 kDa

MFTINILLLIIPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADAIKLFTKEPLQPSTSSTSMFIIAPIMALTLALTMWVPLPMPHPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLITTQEHLWLIFPSWPLTMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNAFTTILFLGAFHNPYMPELYTVNFTIKTLLLTISFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPITMSSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.692 kDa

MFMANLLLVILPALVAMAFLTLTERKVLGYMQFRKGPNIVGPYGMLQPFADAMKLFTKEPLLPTTSTSMLYLTAPALALSIALLLWTPLPMPXPLMNFNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFNLQSLITTQEHSWLLFPSWPLAMMWFTSTLAETNRAPXDLTEGESELVSGFNIEYAXGSFALFFMGEYMNIIMMNALTTTIFLAASYNMMTPETYSINFMAKALLLTTLFLWIRAAYPRFRYDQLMHLLWKNFLPLTLALCMWYISMPTLTSSIPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.641 kDa

MFMINLLVVILSALVAMAFLTLTERKVLGYMQFRKGPNIVGPYGTLQPIADAMKLFTKEPLLPTSSTSTLYLIAPTLALSISLLLWTPLPMPYPLMNFNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSVLLMSGSFNLQSLITTQEHSWLLFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNIEYAAGSFALFFMAEYMNIIMMNALTTTIFLAAPHNTAAPETYTINFMTKTLLLTTLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALCMWYISMPTLTSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.806 kDa

MFTINLLLLITPALIAMAFLTLMERKILGYMQLRKGPNTVGPYGVLQPIADAMKLFTKEPLLPSVSTTTLYMAAPTLALTIALLLWTPLPMPYSLINFNLGLLFVLATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYGVTLAIILLSTLLMSGSFNLHSLITTQEQSWLLLPSWPLTMMWFISTLAETNRAPFDLTEGESELISGFNIEYAAGSFALFFMAEYMNIIMMNALTTTIFTATPYNMLTTELYTMNFMTKTLLLTILFLWIRTAYPRFRYDQLMYLLWKKFLPLTLALCMWYISMPMLLSGIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.725 kDa

MFTINLLLYIIPILLAVAFLTLIERKVLGYMQFRKGPNMVGPYGLLQPFADAVKLFTKEPLHPLTSSTSMFIIAPILALSIALTIWTPLPMPNTLLDLNLGLIFILSLSGLSVYSILWSGWASNSKYALIGALRAVAQTISYEVSLAIILLSIMLINGSFTLKTMSVTQENFWLIITTWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIAMNAITTILFLGPSLMPNLSHLNTMSFMTKTLLLTMTFLWVRASYPRFRYDQLMHLLWKNFLPMTLAMCLWFISLPIALSCIPPQM

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

318 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

35.867 kDa

MFMINVLTLIIPILLAVAFLTLVERKVLGYMQFRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSISMFILAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEQVWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTTTLFLGAFHNPYMPELYTINFTIKSLLLSITFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILLSSIPPQT

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

310 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

36.376 kDa

MYLISFVLMLVCVLVSVGFFTLMERKSLGYIQFRKGPNKVGYMGILQPFSDGMSLFIKEQLFPMNSNYLIYLICPILGLVQSLFIWVLFPFYVNCVEFDLGLLFFLSCSSMGVYGLMICGWSSNSMYSMLGCIRSVSQAISYEVSLSMILLGFFLLIDSYNFMDYFYYQKFVWFSILSLPMCFCWLSCCMAETNRTPFDFSEGESELVSGFNVEYGGGMFALLFISEYLSIIFICLVSCIIFFGSDFNSLFFYIKLIFLCFFFIWVRSTLPRFRYDKLMFLAWKCYLPISLYYIYFFFSLKSLCFYHFFL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

303 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

34.223 kDa

single

ILLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPMTSSIYMFILAPILALSLALTIWVPLPMPLPLIDLNLGLLFVLSVSGLSVYSILWSGWASNSKYALTGALRAVAQTISYEVTLAIILLSIMLINGSFTLTTLNLTQEFMWLVVPTWPLMLTRFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGAYHLIFLPELSTINFMIKTMMLTSLFLWIRASYPRFRYDQLMHLLWKNFLPITLVTCLWFIMLPLALSWIP

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

303 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

33.84 kDa

single

ILLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPLTSSKPMFILAPTLAFSLALSLWIPVPMPHPLINLNLGVLFILALSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSIMMMNGSFTLSTLTTTQEHLWLVFPLWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTTTLFLGALHNPLFPELFTVNFVTKTLLLTITFLWVRASYPRFRYDQLMHLVWKSFLPLTLALCMLHVSTPAMSAGIP

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

301 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

33.958 kDa

single

LTTIIPILLAVAFLTLLERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFIKEPLQPLTSSLALFIIAPTLALTLALMMWIPLPMPHPLINMNLSILFMLALSSLAVYAILWSGWASNSKYALIGALRAVAQTISYEVTLAIIILSILLMNGSFTLSTLITTQEYTWLIMPSWPLAMMWFISTIAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANIIMMNALTIILFLGAYNNSTFPEMYTANFMLKALLFTTFFLWIRASYPRFRYDQLMHLLWKNFLPLTLVMCMWHVTL

MT-ND1

NADH-ubiquinone oxidoreductase chain 1

117 amino acids

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Belongs to the complex I subunit 1 family.

12.902 kDa

single

MPQTTMVSYLIMALLYIIPILIAVAFLTLVERKILSYMQSRKGPNIVGPFGLLQPIADGIKLFIKEPIRPSTSSPLLFIMMPMLALLLALTAWVPLPLPFSLVDLNLGVLFMVAMSS