MRL7L

Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic

350 amino acids

Plays an essential role in early steps of chloroplast development (PubMed:21515910, PubMed:24111559). Involved in the regulation of plastid gene expression (PubMed:21515910, PubMed:24111559). Required for the proper function of the plastid transcriptional machinery and protein accumulation in thylakoid membranes. May function as molecular chaperone to ensure proper organization of the nucleoids in chloroplasts (PubMed:24111559).

40.54 kDa

MILPFSTQFTCPVQDNGFSPSSLLSHCKRDRFEVTSLRYDSFGSVKTASSSKWNVMRSRRNVKAFGLVDKLGKKVWRKKEEDSDSEDEEDEVKEETFGGKEASLDDPVERREWRKTIREVIDKHPDIEEDEEIDMVEKRRKMQKLLADYPLVVNEEDPNWPEDADGWGFSFNQFFNKITIKNEKKEEEDDDEDSEGDDSEKEIVWQDDNYIRPIKDLTTAEWEEAVFKDISPLMVLVHNRYKRPKENEKFREELEKAIQVIWNCGLPSPRCVAVDAVVETDLVSALKVSVFPEIIFTKAGKILYREKGIRTADELSKIMAFFYYGAAKPPCLNGVVNSQEQIPLVDVSVN

MRL7L

Thioredoxin-like fold domain-containing protein MRL7L homolog, chloroplastic

329 amino acids

Plays an essential role in early steps of chloroplast development. Involved in the regulation of plastid gene expression. Required for the proper function of the plastid transcriptional machinery and protein accumulation in thylakoid membranes. May function as molecular chaperone to ensure proper organization of the nucleoids in chloroplasts.

37.211 kDa

MALQSCCSSSASVPATCSALCLAEATRAASLFVRPRAAARRLVLARCARGREGGESKAVQLVLGGRARDDGSESESSDDEDDDEPMQMTDEQRRTLRRKIREMMDRVPETAEITDPAERKAKMLELLTKYQLVVEEEDPNWPEDDEDGHGFSLGQFFDKITIKAEKKNDDDEEDDAKGNQSDKEIVWEDDNYIKPIRDVKTMDWDDTVFTDFGPLIVLVHNRYKRPQDNENARDQLVKAIEMFWEYNLPSPRCVAVDACAEPDLVKALNVSGFPEVLFTNAGKIVHRDKVVRSAEEWTRMMAFFYYKAARPPCLSEADGQGQEKVPLMS