About Products Protein Database Contact

MPN_290

Gene
MPN_290
Protein
Putative type-1 restriction enzyme specificity protein MPN_290
Organism
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Length
145 amino acids
Function
The M and S subunits together form a methyltransferase (MTase) that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. Subunit S dictates DNA sequences specificity (By similarity).
Similarity
Belongs to the type-I restriction system S methylase family.
Mass
16.827 kDa
Sequence
MVYSKTFRVEEKSITVSARGTIGVVFYRDFAYLPAVSLICFVPKEEFDIRFLFHALRAIKFKKQGSATGQLTVAQFKEYGIHVPSLKKQKEIAAILDPLYSFFTDLNEGLPAEIELRKKQLDYYQNFLFNWIQKQKELVEQASTN