About Products Protein Database Contact

MPN_101

Gene
MPN_101
Protein
Uncharacterized protein MPN_101
Organism
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Length
428 amino acids
Similarity
Belongs to the adhesin P1 family.
Mass
46.909 kDa
Sequence
MRDNSAKGITAGSESQQTTYDPTRTEAALTASTTFALRRYDLAGRALYDLDFSRLNPQTPTRDQTGQITFNPFGGFGLSGAAPQQWNEVKNKVPVEVAQDPSNPYRFAVLLVPRSVVYYEQLQRGLALPNQGSSSGSGQQNTTIGAYGLKVKNAEADTAKSNEKLQGDESKSSNGSSSTSTTTQRGGSSGDTKVKALQVAVKKKSGSQGNSGEQGTEQVELESNDLANAPIKRGEESGQSVQLKAADFGTTPSSSGSGGNSNPGSPTPWRPWLATEQIHKDLPKWSASILILYDAPYARNRTAIDRVDHLDPKVMTANYPPSWRTPKWNHHGLWDWKARDVLLQTTGFFNSRRHPEWFDQGQAVADNTQTGFDTDDTDNKKTRLSKGSWLRQAGPDRPPVWSVLRQHWQPHLVRASAFGVWDLFVLIN