About Products Protein Database Contact

MPN_007

Gene
MPN_007
Protein
Uncharacterized protein MG007 homolog
Organism
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Length
253 amino acids
Mass
29.056 kDa
Sequence
MFNPTHALLIIQRRGSYLQPVLTEYLTRVVCEQQTGCQTCPSCLEILHGTYNNFYSFDQANPFKREHALHLSEVLNRQSESNQKQLYLIKNLETLTATAMNSLLRLIEEHPVNTYGVFTTKNENMILPTILSRVQKVVLKKATQLPFQVDSKDQAILKSFFSVDEQLQALDNGSFTRLKTIITTLTNKKNTASTVHEAWVLFKQLNQTETAQVLNFMVDYTKDLTKKDRLLNMVQNLVFNPPKAALFANLINW