MOSPD1

Motile sperm domain-containing protein 1

213 amino acids

Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation.

24.226 kDa

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCMDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRIKEHLTESLFFEQSFQPENRTVSSGPSLLTVFLAVVCITALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAIFRT

MOSPD1

Motile sperm domain-containing protein 1

213 amino acids

Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation.

24.086 kDa

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT

Mospd1

Motile sperm domain-containing protein 1

213 amino acids

Plays a role in differentiation and/or proliferation of mesenchymal stem cells (PubMed:21792907, PubMed:26175344). Proposed to be involved in epithelial-to-mesenchymal transition (EMT) (PubMed:21792907). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation (PubMed:26175344).

24.074 kDa

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT

MOSPD1

Motile sperm domain-containing protein 1

213 amino acids

Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation.

24.085 kDa

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVNAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRIKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT

Mospd1

Motile sperm domain-containing protein 1

213 amino acids

Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation.

24.088 kDa

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVIDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT